Comparing SMc04259 FitnessBrowser__Smeli:SMc04259 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
36% identity, 94% coverage: 26:410/411 of query aligns to 5:395/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
36% identity, 94% coverage: 26:410/411 of query aligns to 5:395/396 of 5dviA
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
38% identity, 81% coverage: 25:357/411 of query aligns to 6:336/395 of 4r2bA
Sites not aligning to the query:
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
36% identity, 80% coverage: 27:355/411 of query aligns to 6:337/398 of 8hqqA
Sites not aligning to the query:
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
29% identity, 79% coverage: 26:350/411 of query aligns to 3:327/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
29% identity, 79% coverage: 26:350/411 of query aligns to 3:327/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
29% identity, 79% coverage: 26:350/411 of query aligns to 3:327/392 of 2b3bA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
27% identity, 47% coverage: 72:264/411 of query aligns to 49:238/390 of 3oo6A
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
28% identity, 44% coverage: 89:269/411 of query aligns to 69:251/396 of 4c1tA
Sites not aligning to the query:
7ehpA Chitin oligosaccharide binding protein (see paper)
23% identity, 68% coverage: 75:355/411 of query aligns to 55:339/397 of 7ehpA
Sites not aligning to the query:
3vxcA Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
25% identity, 47% coverage: 74:266/411 of query aligns to 50:249/398 of 3vxcA
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
30% identity, 33% coverage: 71:205/411 of query aligns to 55:189/406 of 7ehqA
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
21% identity, 65% coverage: 70:337/411 of query aligns to 45:314/385 of 2i58A
Sites not aligning to the query:
6preA Sbp rafe in complex with verbascose (see paper)
21% identity, 65% coverage: 70:337/411 of query aligns to 46:315/386 of 6preA
Sites not aligning to the query:
>SMc04259 FitnessBrowser__Smeli:SMc04259
MNLRFLAAALGATAALPFGAASATDLEVTHWWTSGGEAAAVAELAKAFDATGNKWVDGAI
AGSGGTARPIMISRITGGDPMAATQFNHGRQAEELVQAGLMRDLTDIATKENWKEIVKPS
SLLDSCTIEGKIYCAPVNIHSWQWLWLSNAAFKQAGVEVPKNWDEFVAAAPALEKAGIVP
LAVGGQPWQANGAFDVLMVAIAGKENFEKVFAQKDEEVAAGPEIAKVFKAADDARRMSKG
TNVQDWNQATNMVITGKAGGQIMGDWAQGEFQLAGQKAGVDYTCLPGLGVNEVISTGGDA
FYFPLLEDEEKSKAQEVLASTLLKPETQVAFNLKKGSLPVRGDVDLAAANDCMKKGLDIL
AKGNVIQGTDQLLSADSQKQKEDLFSEFFANHSMTPEDAQKRFADIIAAAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory