Comparing SMc04308 FitnessBrowser__Smeli:SMc04308 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
25% identity, 86% coverage: 31:263/271 of query aligns to 9:266/269 of 5h3hB
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
26% identity, 88% coverage: 27:265/271 of query aligns to 3:271/271 of 3ia2A
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
26% identity, 88% coverage: 27:265/271 of query aligns to 4:272/272 of P22862
Sites not aligning to the query:
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
25% identity, 88% coverage: 27:265/271 of query aligns to 3:271/276 of 8pi1B
Sites not aligning to the query:
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
25% identity, 88% coverage: 27:265/271 of query aligns to 3:271/271 of 3hi4A
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
25% identity, 88% coverage: 27:265/271 of query aligns to 3:271/271 of 3heaA
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
26% identity, 81% coverage: 27:245/271 of query aligns to 3:242/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
25% identity, 81% coverage: 27:245/271 of query aligns to 3:239/262 of 6eb3C
2ociA Crystal structure of valacyclovir hydrolase complexed with a product analogue (see paper)
25% identity, 87% coverage: 28:263/271 of query aligns to 7:253/254 of 2ociA
2ocgA Crystal structure of human valacyclovir hydrolase (see paper)
25% identity, 87% coverage: 28:263/271 of query aligns to 7:253/254 of 2ocgA
Q86WA6 Valacyclovir hydrolase; VACVase; Valacyclovirase; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Breast epithelial mucin-associated antigen; MCNAA; EC 3.1.-.- from Homo sapiens (Human) (see 2 papers)
25% identity, 92% coverage: 16:263/271 of query aligns to 32:290/291 of Q86WA6
Sites not aligning to the query:
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
24% identity, 81% coverage: 27:245/271 of query aligns to 3:245/268 of 6eb3B
1hl7A Gamma lactamase from an aureobacterium species in complex with 3a,4,7, 7a-tetrahydro-benzo [1,3] dioxol-2-one (see paper)
26% identity, 85% coverage: 35:265/271 of query aligns to 15:279/279 of 1hl7A
4nvrA 2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica
32% identity, 48% coverage: 11:141/271 of query aligns to 3:137/302 of 4nvrA
Sites not aligning to the query:
2zjfA Crystal structure of mycobacterium tuberculosis epoxide hydrolase b complexed with an inhibitor (see paper)
35% identity, 44% coverage: 43:161/271 of query aligns to 24:144/346 of 2zjfA
Sites not aligning to the query:
6i5gA X-ray structure of human soluble epoxide hydrolasE C-terminal domain (hseh ctd)in complex with 15d-pgj2 (see paper)
29% identity, 52% coverage: 20:160/271 of query aligns to 5:153/316 of 6i5gA
Sites not aligning to the query:
8qmzA Soluble epoxide hydrolase in complex with rk4 (see paper)
29% identity, 52% coverage: 20:160/271 of query aligns to 7:155/320 of 8qmzA
Sites not aligning to the query:
7ebaA Co-crystal of kurarinone with seh (see paper)
29% identity, 52% coverage: 20:160/271 of query aligns to 4:152/316 of 7ebaA
Sites not aligning to the query:
6yl4A Soluble epoxide hydrolase in complex with 3-((r)-3-(1-hydroxyureido) but-1-yn-1-yl)-n-((s)-3-phenyl-3-(4-trifluoromethoxy)phenyl)propyl) benzamide (see paper)
29% identity, 52% coverage: 20:160/271 of query aligns to 6:154/319 of 6yl4A
Sites not aligning to the query:
6hgxA Soluble epoxide hydrolase in complex with 1-(4-((4-(tert-butyl) morpholin-2-yl)methoxy)phenyl)-3-cyclohexylurea (see paper)
29% identity, 52% coverage: 20:160/271 of query aligns to 6:154/319 of 6hgxA
Sites not aligning to the query:
>SMc04308 FitnessBrowser__Smeli:SMc04308
MQQYDDDLRQFEARGAPALPPAAEQGYVERDGARIWYSTYGAGAPVVLLHGGLGHSGNWG
YQLAPLLDAGRRVVLIDSRGHGRSTRDERPYSYEVMASDVLAVADMLQLQKFAVVGWSDG
ACIGLVLANRAPERIAGVFFFACNMDPSGATEFEATPVIDRCFARHRKDYAELSATPDQF
DDFVSAVSEMMSTQPNYSAGDLAEIRVPVAVVQAEKDEFIKWEHAQYLARSIPAADLIAL
EHVSHFAPLQRPDVFNGAMLAFLDKVLPTRT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory