SitesBLAST
Comparing SMc04384 FitnessBrowser__Smeli:SMc04384 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
35% identity, 95% coverage: 18:464/473 of query aligns to 24:454/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R335), T337 (≠ S339), K348 (≠ A350), Y379 (≠ F383), H381 (= H385), H388 (= H392), H423 (= H433)
- binding flavin-adenine dinucleotide: W39 (vs. gap), P75 (= P68), Q76 (= Q69), G77 (≠ S70), G78 (= G71), N79 (= N72), T80 (= T73), G81 (= G74), M82 (≠ L75), G85 (= G78), S86 (= S79), L139 (= L134), G140 (= G135), A141 (= A136), C145 (≠ P138), G149 (= G142), N150 (≠ M143), A152 (= A145), T153 (= T146), G157 (= G150), G207 (= G202), I212 (≠ V207), E422 (= E432)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E432)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
35% identity, 95% coverage: 18:464/473 of query aligns to 24:454/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (vs. gap), P75 (= P68), G77 (≠ S70), G78 (= G71), N79 (= N72), T80 (= T73), G81 (= G74), G85 (= G78), S86 (= S79), L139 (= L134), G140 (= G135), A141 (= A136), C145 (≠ P138), H146 (≠ R139), G148 (= G141), G149 (= G142), N150 (≠ M143), A152 (= A145), T153 (= T146), A155 (≠ T148), E206 (≠ S201), G207 (= G202), I211 (= I206), I212 (≠ V207), E422 (= E432)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R335), T337 (≠ S339), K348 (≠ A350), Y379 (≠ F383), H381 (= H385), H388 (= H392), H423 (= H433)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E432)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
35% identity, 95% coverage: 18:464/473 of query aligns to 24:454/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (vs. gap), P75 (= P68), G77 (≠ S70), G78 (= G71), N79 (= N72), T80 (= T73), G81 (= G74), G85 (= G78), S86 (= S79), L139 (= L134), G140 (= G135), A141 (= A136), C145 (≠ P138), H146 (≠ R139), G149 (= G142), N150 (≠ M143), A152 (= A145), T153 (= T146), A155 (≠ T148), G157 (= G150), E206 (≠ S201), G207 (= G202), I211 (= I206), I212 (≠ V207), E422 (= E432)
- binding d-malate: M82 (≠ L75), R333 (= R335), T337 (≠ S339), K348 (≠ A350), Y379 (≠ F383), H381 (= H385), H388 (= H392), E422 (= E432), H423 (= H433)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E432)
Sites not aligning to the query:
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
35% identity, 95% coverage: 18:464/473 of query aligns to 24:454/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R335), T337 (≠ S339), K348 (≠ A350), Y379 (≠ F383), H381 (= H385), H388 (= H392), N390 (= N394), H423 (= H433)
- binding flavin-adenine dinucleotide: W39 (vs. gap), P75 (= P68), G77 (≠ S70), G78 (= G71), N79 (= N72), T80 (= T73), G81 (= G74), M82 (≠ L75), G85 (= G78), S86 (= S79), L139 (= L134), G140 (= G135), A141 (= A136), C145 (≠ P138), G149 (= G142), N150 (≠ M143), A152 (= A145), T153 (= T146), A155 (≠ T148), G157 (= G150), G207 (= G202), I212 (≠ V207), E422 (= E432), H423 (= H433)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E432)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
35% identity, 95% coverage: 18:464/473 of query aligns to 25:455/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (vs. gap), P76 (= P68), G78 (≠ S70), G79 (= G71), N80 (= N72), T81 (= T73), G82 (= G74), M83 (≠ L75), G86 (= G78), S87 (= S79), L140 (= L134), A142 (= A136), C146 (≠ P138), H147 (≠ R139), G150 (= G142), N151 (≠ M143), A153 (= A145), T154 (= T146), G208 (= G202), I212 (= I206), I213 (≠ V207), E423 (= E432)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
35% identity, 95% coverage: 18:464/473 of query aligns to 77:507/521 of Q8N465
- S109 (≠ T49) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ I67) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G71) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V89) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L95) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ F114) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P131) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A145) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A171) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G175) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D322) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R335) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S339) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ L348) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ A350) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ K368) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G377) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H385) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G387) to V: slight reduction in catalytic activity
- N439 (≠ G390) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H392) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N394) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ L395) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ V397) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E432) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H433) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (≠ A434) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
34% identity, 97% coverage: 7:467/473 of query aligns to 7:464/465 of 3pm9A
- active site: A149 (≠ T148), L159 (≠ D158)
- binding flavin-adenine dinucleotide: P69 (= P68), Q70 (= Q69), G71 (≠ S70), G72 (= G71), N73 (= N72), T74 (= T73), G75 (= G74), L76 (= L75), G79 (= G78), Q80 (≠ S79), L91 (= L92), L133 (= L134), G134 (= G135), A135 (= A136), C139 (≠ P138), T140 (≠ R139), G142 (= G141), G143 (= G142), S146 (≠ A145), T147 (= T146), A149 (≠ T148), G150 (= G149), E200 (≠ S201), G201 (= G202), I205 (= I206), I206 (≠ V207), E423 (= E432)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 85% coverage: 37:436/473 of query aligns to 65:458/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 90% coverage: 43:467/473 of query aligns to 48:457/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P68), G75 (≠ S70), S76 (≠ G71), G77 (≠ N72), T78 (= T73), G79 (= G74), L80 (= L75), A83 (≠ G78), C84 (≠ S79), P137 (≠ L134), G138 (= G135), E139 (vs. gap), A142 (≠ P138), T143 (≠ R139), G146 (= G142), N147 (≠ M143), S149 (≠ A145), T150 (= T146), A152 (≠ T148), G153 (= G149), E203 (≠ S201), G204 (= G202), I209 (≠ V207), E422 (= E432), H423 (= H433)
- binding fe (iii) ion: H377 (= H385), H384 (= H392), E422 (= E432)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
26% identity, 99% coverage: 2:467/473 of query aligns to 1:454/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), W322 (vs. gap), E413 (= E432), H414 (= H433), N450 (≠ S463)
- binding lactic acid: R318 (= R335), H369 (= H385), H376 (= H392), H414 (= H433)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E432)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
26% identity, 99% coverage: 2:467/473 of query aligns to 1:453/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L75), R317 (= R335), W321 (vs. gap), H368 (= H385), H375 (= H392), H413 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), W321 (vs. gap), Y322 (vs. gap), E412 (= E432), H413 (= H433), N449 (≠ S463)
- binding manganese (ii) ion: H368 (= H385), H375 (= H392), E412 (= E432)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
25% identity, 99% coverage: 2:467/473 of query aligns to 1:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A33), P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), W322 (vs. gap), E413 (= E432), H414 (= H433), N450 (≠ S463)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R335), H369 (= H385), H376 (= H392), H414 (= H433)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E432)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
26% identity, 99% coverage: 2:467/473 of query aligns to 1:454/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R335), H369 (= H385), H376 (= H392), H414 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), W322 (vs. gap), E413 (= E432), H414 (= H433), N450 (≠ S463)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E432)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
26% identity, 99% coverage: 2:467/473 of query aligns to 1:455/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A33), P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), W323 (vs. gap), E414 (= E432), H415 (= H433), N451 (≠ S463)
- binding manganese (ii) ion: H370 (= H385), H377 (= H392), E414 (= E432)
- binding pyruvic acid: R319 (= R335), H370 (= H385), H377 (= H392), H415 (= H433)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
25% identity, 99% coverage: 2:467/473 of query aligns to 1:453/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R335), W322 (vs. gap), H369 (= H385), H376 (= H392), H413 (= H433)
- binding flavin-adenine dinucleotide: E32 (≠ A33), P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), W322 (vs. gap), E412 (= E432), H413 (= H433), N449 (≠ S463)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E412 (= E432)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
25% identity, 99% coverage: 2:467/473 of query aligns to 1:453/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R335), W322 (vs. gap), S336 (≠ G346), H369 (= H385), H376 (= H392), H413 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), E412 (= E432), N449 (≠ S463)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E412 (= E432)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
25% identity, 99% coverage: 2:467/473 of query aligns to 1:454/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R335), W322 (vs. gap), H369 (= H385), H376 (= H392), H414 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), W322 (vs. gap), E413 (= E432), N450 (≠ S463)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E432)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
25% identity, 99% coverage: 2:467/473 of query aligns to 1:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), Y324 (vs. gap), H370 (= H385), E414 (= E432), N451 (≠ S463)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R335), W323 (vs. gap), H415 (= H433)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
25% identity, 99% coverage: 2:467/473 of query aligns to 1:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R335), W323 (vs. gap), H370 (= H385), H415 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), H370 (= H385), E414 (= E432), N451 (≠ S463)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
25% identity, 99% coverage: 2:467/473 of query aligns to 1:455/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R335), W323 (vs. gap), H415 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (≠ S70), T71 (≠ G71), G72 (≠ N72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ S79), L90 (= L92), P132 (≠ L134), G133 (= G135), A134 (= A136), G140 (= G142), M141 (= M143), A143 (= A145), T144 (= T146), A146 (≠ T148), S147 (≠ G149), E200 (≠ S201), G201 (= G202), I206 (≠ V207), Y324 (vs. gap), H370 (= H385), E414 (= E432), N451 (≠ S463)
Query Sequence
>SMc04384 FitnessBrowser__Smeli:SMc04384
MIDEHHIDALTKLLGDKGVVTRREDMEAYEAGARYDRGRAAAVLRPVTTEEVSAAVGYCV
RSGIALIPQSGNTGLVSGSTPDESGSEVVVSLDRLTRQFALDLDNRSVRVDAGFRLSELN
RRLEEHGLFFPIDLGADPRIGGMIATNTGGSRFLKYGDVRRNTLGLKVVLADEAGTVLDL
GSDLRKNNTGVDWKQIFIGTSGAFGIVTECVLNLERLPKQTATAFLVPASGAHVLPLLKA
MEERLGAYLSAFEGMSRNAIAAAFAHVPALKNPFQGGKVPDYVILAEISRTSSPREGEQP
LDAVLESVLAEIWEMEEVLLADALVGPPHEIWALRHALSEGVKHLGKLIAFDLSFRRGDI
MAFCDHMKTEMPEKFPGVTVCDFGHIGDGGVHFNLVVAKDSPLLADATFEQRLREWVFAV
AVEQYHGSFSAEHALGRRNQAFYDLYTPEKLKNMAAGLKTLTSPGKLGSVRFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory