Comparing SMc04396 FitnessBrowser__Smeli:SMc04396 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
86% identity, 94% coverage: 24:414/414 of query aligns to 5:395/395 of 4r2bA
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
50% identity, 94% coverage: 26:414/414 of query aligns to 5:396/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
50% identity, 94% coverage: 26:414/414 of query aligns to 5:396/396 of 5dviA
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
48% identity, 92% coverage: 23:401/414 of query aligns to 2:385/398 of 8hqqA
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
28% identity, 85% coverage: 26:378/414 of query aligns to 3:353/392 of 2b3fA
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
28% identity, 85% coverage: 26:378/414 of query aligns to 3:353/392 of 2b3bC
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
28% identity, 85% coverage: 26:378/414 of query aligns to 3:353/392 of 2b3bA
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
28% identity, 48% coverage: 89:287/414 of query aligns to 66:260/390 of 3oo6A
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
27% identity, 53% coverage: 72:291/414 of query aligns to 55:278/406 of 7ehqA
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
27% identity, 54% coverage: 70:291/414 of query aligns to 46:269/392 of 4g68A
Sites not aligning to the query:
7c0kB Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
25% identity, 77% coverage: 19:337/414 of query aligns to 12:318/397 of 7c0kB
Sites not aligning to the query:
7c0oB Crystal structure of a dinucleotide-binding protein (y56f) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (see paper)
25% identity, 77% coverage: 19:337/414 of query aligns to 11:317/397 of 7c0oB
Sites not aligning to the query:
7c0kA Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
25% identity, 77% coverage: 19:337/414 of query aligns to 11:317/396 of 7c0kA
Sites not aligning to the query:
3vxcA Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
27% identity, 33% coverage: 128:265/414 of query aligns to 107:249/398 of 3vxcA
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
26% identity, 53% coverage: 127:344/414 of query aligns to 105:336/396 of 4c1tA
Sites not aligning to the query:
2gh9A Thermus thermophilus maltotriose binding protein bound with maltotriose (see paper)
27% identity, 42% coverage: 120:292/414 of query aligns to 94:257/378 of 2gh9A
Sites not aligning to the query:
A0A0H2URD6 Fructooligosaccharide ABC transporter substrate-binding protein FusA; FOS ABC transporter SBP FusA from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
29% identity, 24% coverage: 76:173/414 of query aligns to 97:212/538 of A0A0H2URD6
Sites not aligning to the query:
>SMc04396 FitnessBrowser__Smeli:SMc04396
MRKFMTTTAVAALMLAATAARAAENVEVLHWWTSGGEAAALDVLKKDLESKGISWTDMPV
AGGGGTEAMTVLRARVTAGNAPTAVQMLGFDILDWAKEGALGNLDEVAAKEGWDKVVPAA
LQQFSKYDGHWIAAPVNVHSTNWVWINKAALDKAGAKEPTTWEELIALLDKFKEQGITPI
AHGGQPWQDATIFDAVVLSLGNDFYKQAFIDLDPAALGGDKMKEAFDRMTKLRSYVDDNF
SGRDWNLASAMVIENKAGLQFMGDWAKGEFLKAKKVPGTDFVCMRFPGTQGSVTFNSDQF
AMFKVSEDKVPAQLQMASAIESPAFQSAFNVVKGSVPARTDVPDTDFDACGKKGIKDLAE
ANTNGTLFGSMAHGHANPAAVKNAIYDVVTRQFNGELNSEEAVTELVAAVEAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory