Comparing Synpcc7942_0278 FitnessBrowser__SynE:Synpcc7942_0278 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a6tC Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
40% identity, 91% coverage: 11:160/165 of query aligns to 1:150/151 of 8a6tC
8a5eC Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
50% identity, 71% coverage: 31:147/165 of query aligns to 27:143/156 of 8a5eC
7t2rC Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
45% identity, 80% coverage: 30:161/165 of query aligns to 21:152/152 of 7t2rC
8oh5A Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
42% identity, 86% coverage: 17:158/165 of query aligns to 6:147/150 of 8oh5A
O52681 Bifurcating [FeFe] hydrogenase gamma subunit; Hydrogenase (NAD(+), ferredoxin) gamma subunit; Iron-hydrogenase gamma subunit; EC 1.12.1.4 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 90% coverage: 16:163/165 of query aligns to 7:154/161 of O52681
7p5hC Tmhydabc- d2 map (see paper)
35% identity, 90% coverage: 16:163/165 of query aligns to 4:151/156 of 7p5hC
8eswV2 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
36% identity, 85% coverage: 3:143/165 of query aligns to 9:156/214 of 8eswV2
8b9zE Drosophila melanogaster complex i in the active state (dm1) (see paper)
36% identity, 85% coverage: 3:143/165 of query aligns to 9:156/214 of 8b9zE
6r7pA Crystal structure of oxidized aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof s96m (see paper)
34% identity, 87% coverage: 14:157/165 of query aligns to 10:152/157 of 6r7pA
5gupE structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
37% identity, 75% coverage: 15:138/165 of query aligns to 39:164/197 of 5gupE
Q9D6J6 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see paper)
39% identity, 75% coverage: 15:138/165 of query aligns to 60:185/248 of Q9D6J6
P9WIV5 NADH-quinone oxidoreductase subunit E; NADH dehydrogenase I subunit E; NDH-1 subunit E; EC 7.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 87% coverage: 21:163/165 of query aligns to 48:190/252 of P9WIV5
Sites not aligning to the query:
7dgq9 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
37% identity, 75% coverage: 15:138/165 of query aligns to 22:147/207 of 7dgq9
Sites not aligning to the query:
P19404 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NDUFV2; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see 2 papers)
37% identity, 75% coverage: 15:138/165 of query aligns to 61:186/249 of P19404
Sites not aligning to the query:
P04394 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH dehydrogenase subunit II; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see 2 papers)
37% identity, 75% coverage: 15:138/165 of query aligns to 61:186/249 of P04394
Sites not aligning to the query:
7v2cO Active state complex i from q10 dataset (see paper)
37% identity, 75% coverage: 15:138/165 of query aligns to 29:154/217 of 7v2cO
8e9gE Mycobacterial respiratory complex i with both quinone positions modelled (see paper)
34% identity, 90% coverage: 14:162/165 of query aligns to 29:177/233 of 8e9gE
7b0nE 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
34% identity, 78% coverage: 15:143/165 of query aligns to 26:156/216 of 7b0nE
6tg9G Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
36% identity, 87% coverage: 11:153/165 of query aligns to 2:140/148 of 6tg9G
6vw8C Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator (see paper)
39% identity, 71% coverage: 30:146/165 of query aligns to 19:135/152 of 6vw8C
>Synpcc7942_0278 FitnessBrowser__SynE:Synpcc7942_0278
MATSETTPSVDPRRRRLELAIKRQAAQADALIEILHEAQSLYGYLDRELLQWVAEQLALP
RSKVYGVASFYHLFQLNPSGRHRCHVCLGTACYVKGSQAILDCLIAELGIREGETTNDGS
VSLGTVRCVGACGIAPVVVYDGDIQGRQESEAVWQQVQAWQQEAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory