Comparing Synpcc7942_0354 FitnessBrowser__SynE:Synpcc7942_0354 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6k5jA Structure of a glycoside hydrolase family 3 beta-n- acetylglucosaminidase from paenibacillus sp. Str. Fpu-7 (see paper)
44% identity, 62% coverage: 12:346/542 of query aligns to 2:330/526 of 6k5jA
3nvdA Structure of ybbd in complex with pugnac (see paper)
34% identity, 76% coverage: 12:425/542 of query aligns to 17:445/617 of 3nvdA
Sites not aligning to the query:
3bmxA Beta-n-hexosaminidase (ybbd) from bacillus subtilis (see paper)
34% identity, 76% coverage: 12:425/542 of query aligns to 17:445/617 of 3bmxA
Sites not aligning to the query:
P40406 Beta-hexosaminidase; Beta-N-acetylhexosaminidase; N-acetyl-beta-glucosaminidase; N-acetylglucosaminidase; ORF1; EC 3.2.1.52 from Bacillus subtilis (strain 168) (see 2 papers)
34% identity, 76% coverage: 12:425/542 of query aligns to 42:470/642 of P40406
4gyjA Crystal structure of mutant (d318n) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group p1) (see paper)
34% identity, 76% coverage: 12:425/542 of query aligns to 18:446/618 of 4gyjA
Sites not aligning to the query:
4zm6A A unique gcn5-related glucosamine n-acetyltransferase region exist in the fungal multi-domain gh3 beta-n-acetylglucosaminidase (see paper)
36% identity, 54% coverage: 55:346/542 of query aligns to 31:332/844 of 4zm6A
Sites not aligning to the query:
5vqeA Beta-glucoside phosphorylase bglx bound to 2fglc (see paper)
30% identity, 72% coverage: 45:432/542 of query aligns to 52:443/559 of 5vqeA
2oxnA Vibrio cholerae family 3 glycoside hydrolase (nagz) in complex with pugnac (see paper)
38% identity, 51% coverage: 44:317/542 of query aligns to 18:281/333 of 2oxnA
6jtkB Crystal structure of nagz from neisseria gonorrhoeae in complex with n-trifluoroacetyl-d-glucosamine
35% identity, 54% coverage: 56:349/542 of query aligns to 31:320/346 of 6jtkB
5c0qB Crystal structure of zn bound cbsa from thermotoga neapolitana (see paper)
33% identity, 52% coverage: 58:337/542 of query aligns to 30:303/457 of 5c0qB
Sites not aligning to the query:
7vi6A Crystal structure of gh3 beta-n-acetylhexosaminidase amuc_2109 from akkermansia muciniphila
33% identity, 49% coverage: 85:348/542 of query aligns to 58:314/342 of 7vi6A
Sites not aligning to the query:
4gvhA Crystal structure of salmonella typhimurium family 3 glycoside hydrolase (nagz) covalently bound to 5-fluoro-glcnac. (see paper)
35% identity, 48% coverage: 56:316/542 of query aligns to 26:286/341 of 4gvhA
Q8ZQ06 Beta-hexosaminidase; Beta-N-acetylhexosaminidase; N-acetyl-beta-glucosaminidase; EC 3.2.1.52 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 48% coverage: 56:316/542 of query aligns to 26:286/341 of Q8ZQ06
3gsmA Vibrio cholerae family 3 glycoside hydrolase (nagz) bound to n- valeryl-pugnac (see paper)
39% identity, 48% coverage: 56:317/542 of query aligns to 26:276/324 of 3gsmA
3gs6A Vibrio cholerea family 3 glycoside hydrolase (nagz)in complex with n- butyryl-pugnac (see paper)
38% identity, 48% coverage: 56:317/542 of query aligns to 26:274/322 of 3gs6A
5g3rA Crystal structure of nagz from pseudomonas aeruginosa in complex with n-acetylglucosamine and l-ala-1,6-anhydromurnac (see paper)
38% identity, 47% coverage: 56:311/542 of query aligns to 30:280/335 of 5g3rA
5g5kA Crystal structure of nagz from pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin (see paper)
38% identity, 47% coverage: 56:311/542 of query aligns to 28:278/333 of 5g5kA
4hzmA Crystal structure of salmonella typhimurium family 3 glycoside hydrolase (nagz) bound to n-[(3s,4r,5r,6r)-4,5-dihydroxy-6- (hydroxymethyl)piperidin-3-yl]butanamide (see paper)
35% identity, 48% coverage: 56:316/542 of query aligns to 26:277/331 of 4hzmA
4gviB Crystal structure of mutant (d248n) salmonella typhimurium family 3 glycoside hydrolase (nagz) in complex with glcnac-1,6-anhmurnac (see paper)
34% identity, 48% coverage: 56:316/542 of query aligns to 26:277/331 of 4gviB
5g6tA Crystal structure of zn-containing nagz h174a mutant from pseudomonas aeruginosa (see paper)
36% identity, 47% coverage: 56:311/542 of query aligns to 28:262/317 of 5g6tA
>Synpcc7942_0354 FitnessBrowser__SynE:Synpcc7942_0354
LSDRFLPDWQTLSLEQQIAQLLVVRTSGAYFDSQIAYPQYEALRDRLQHWIGELGVGGVI
LLGGNAAEVALRCQQLQEWSRVPLLIAADIEEGVGQRFAGAVQFPPPLALSAIAAQDPER
AQQLARSFGEITATEAIAIRLNWVLAPIVDINNNPANPVINVRAFGEDPETVSQLTTAFI
AGAQQFPVLTTAKHFPGHGDTATDSHLELPQIPHDRSRLEAVELEPFRRAIAAGVDAVMT
AHLSIPALDPDYPATLSPAVLQGLLRRELGFEGLIVTDALVMQAIAAHYGPGEAARLAFE
AGADILLMPVDPEAAIQEIAKAIREGQITYDRLEQSLARIWRAKQKVCGARPASFLPHAW
EQEPAIAIDLEAVSQPKHWAIAAEILTASQEQQGQPLAPTAGVNLIVGDRLLQAPYLSGT
AAARQLPSQHGLRLQIWDTETGTTPTLTEPTLVQWFIRGNPFRGSAGADQVVERLLRQLL
TQDQLLGLVIYGSPYIWQQWRSQLPHDLPAIFSYGQTAQAQAIALQSIVQSIDCSQAKEF
TT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory