SitesBLAST
Comparing Synpcc7942_0369 FitnessBrowser__SynE:Synpcc7942_0369 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8p84B X-ray structure of thermoanaerobacterales bacterium monoamine oxidase (see paper)
41% identity, 93% coverage: 33:482/484 of query aligns to 1:447/450 of 8p84B
- binding flavin-adenine dinucleotide: V9 (= V41), G10 (= G42), G12 (= G44), A14 (= A46), E33 (= E65), A34 (= A66), R35 (= R67), G40 (= G72), R41 (= R73), T42 (≠ V74), G56 (= G89), Q57 (= Q90), W58 (= W91), V234 (= V267), V262 (= V295), W383 (= W418), W388 (= W423), C392 (= C427), Y393 (= Y428), G420 (= G455), T421 (= T456), G429 (≠ T464), Y430 (≠ F465), I431 (= I466), A434 (= A469)
- binding magnesium ion: E125 (≠ D160), H188 (≠ R222)
3rhaA The crystal structure of oxidoreductase from arthrobacter aurescens
36% identity, 92% coverage: 37:480/484 of query aligns to 7:446/459 of 3rhaA
- active site: S62 (≠ G93), S197 (≠ A228), K295 (= K327)
- binding dihydroflavine-adenine dinucleotide: V11 (= V41), G12 (= G42), G14 (= G44), P15 (≠ Y45), S16 (≠ A46), E35 (= E65), A36 (= A66), R37 (= R67), G42 (= G72), R43 (= R73), G57 (= G88), G58 (= G89), Q59 (= Q90), W60 (= W91), P234 (= P266), V235 (= V267), V263 (= V295), W384 (= W418), W389 (= W423), Y394 (= Y428), S421 (≠ G455), S422 (≠ T456), Q430 (≠ T464), H431 (≠ F465), V432 (≠ I466)
2yg4A Structure-based redesign of cofactor binding in putrescine oxidase: wild type bound to putrescine (see paper)
37% identity, 92% coverage: 37:483/484 of query aligns to 6:449/449 of 2yg4A
- active site: S61 (≠ G93), S196 (≠ A228), K295 (= K327)
- binding 4-hydroxybutan-1-aminium: G171 (≠ S203), E323 (= E355), Y394 (= Y428)
- binding flavin-adenine dinucleotide: V10 (= V41), G11 (= G42), G13 (= G44), P14 (≠ Y45), S15 (≠ A46), E34 (= E65), A35 (= A66), R36 (= R67), G41 (= G72), R42 (= R73), G56 (= G88), G57 (= G89), Q58 (= Q90), W59 (= W91), V234 (= V267), V263 (= V295), W384 (= W418), W389 (= W423), Y394 (= Y428), C421 (≠ G455), S422 (≠ T456), Q430 (≠ T464), H431 (≠ F465), V432 (≠ I466)
2yg3B Structure-based redesign of cofactor binding in putrescine oxidase: wild type enzyme (see paper)
37% identity, 92% coverage: 37:483/484 of query aligns to 6:449/450 of 2yg3B
- active site: S61 (≠ G93), S196 (≠ A228), K295 (= K327)
- binding flavin-adenine dinucleotide: V10 (= V41), G11 (= G42), G13 (= G44), P14 (≠ Y45), S15 (≠ A46), E34 (= E65), A35 (= A66), R36 (= R67), G41 (= G72), R42 (= R73), G56 (= G88), G57 (= G89), Q58 (= Q90), W59 (= W91), V234 (= V267), V263 (= V295), W384 (= W418), W389 (= W423), Y394 (= Y428), C421 (≠ G455), S422 (≠ T456), Q430 (≠ T464), H431 (≠ F465), V432 (≠ I466), A435 (= A469)
P19643 Amine oxidase [flavin-containing] B; Monoamine oxidase type B; MAO-B; EC 1.4.3.21; EC 1.4.3.4 from Rattus norvegicus (Rat) (see paper)
35% identity, 93% coverage: 33:482/484 of query aligns to 2:452/520 of P19643
- I199 (≠ D231) mutation to F: Increased affinity for serotonin and tyramine.
P21397 Amine oxidase [flavin-containing] A; Monoamine oxidase type A; MAO-A; EC 1.4.3.21; EC 1.4.3.4 from Homo sapiens (Human) (see 6 papers)
33% identity, 92% coverage: 37:482/484 of query aligns to 15:461/527 of P21397
- D15 (= D37) to E: in a breast cancer sample; somatic mutation
- C165 (≠ V189) mutation to S: No loss of activity.
- E188 (= E211) to K: in dbSNP:rs77698881
- C266 (≠ A288) to F: found in a family with Brunner syndrome-like behavioral disturbances; likely pathogenic; reduced activity; dbSNP:rs587777457; mutation to S: No loss of activity.
- C306 (≠ V328) mutation to S: No loss of activity.
- C321 (≠ S343) mutation to S: No loss of activity.
- C323 (≠ A345) mutation to S: No loss of activity.
- C374 (≠ L396) mutation to S: Complete loss of activity.
- C398 (≠ A419) mutation to S: No loss of activity.
- C406 (= C427) modified: S-8alpha-FAD cysteine; mutation to S: Complete loss of activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2z5xA Crystal structure of human monoamine oxidase a with harmine (see paper)
33% identity, 92% coverage: 37:482/484 of query aligns to 4:450/513 of 2z5xA
- active site: G60 (= G93), R195 (≠ M229), K294 (= K327)
- binding decyl(dimethyl)phosphine oxide: V104 (≠ N138), W105 (= W139), Y110 (≠ G144)
- binding flavin-adenine dinucleotide: I8 (≠ V41), G9 (= G42), G11 (= G44), I12 (≠ Y45), S13 (≠ A46), L31 (= L64), E32 (= E65), A33 (= A66), R34 (= R67), G39 (= G72), R40 (= R73), G55 (= G88), G56 (= G89), A57 (≠ Q90), Y58 (≠ W91), P232 (= P266), V233 (= V267), I262 (≠ V295), L266 (= L299), W386 (= W418), Y391 (≠ W423), C395 (= C427), Y396 (= Y428), G423 (= G455), T424 (= T456), G432 (≠ T464), Y433 (≠ F465), M434 (≠ I466)
- binding 7-methoxy-1-methyl-9h-beta-carboline: I169 (≠ Y204), F197 (≠ D231), Q204 (= Q238), I324 (≠ E355), L326 (≠ A357), F341 (= F374), Y396 (= Y428)
Sites not aligning to the query:
1o5wC The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase a (see paper)
33% identity, 92% coverage: 37:482/484 of query aligns to 6:452/512 of 1o5wC
- active site: G62 (= G93), R197 (≠ M229), K296 (= K327)
- binding flavin-adenine dinucleotide: I10 (≠ V41), G13 (= G44), S15 (≠ A46), E34 (= E65), A35 (= A66), R36 (= R67), G41 (= G72), R42 (= R73), G57 (= G88), G58 (= G89), A59 (≠ Q90), Y60 (≠ W91), P234 (= P266), V235 (= V267), I264 (≠ V295), W388 (= W418), Y393 (≠ W423), C397 (= C427), Y398 (= Y428), G425 (= G455), T426 (= T456), G434 (≠ T464), Y435 (≠ F465), M436 (≠ I466)
- binding n-[3-(2,4-dichlorophenoxy)propyl]-n-methyl-n-prop-2-ynylamine: I171 (≠ Y204), F199 (≠ D231), Q206 (= Q238), C314 (≠ A345), I316 (= I347), I326 (≠ E355), T327 (= T356), Y398 (= Y428), Y435 (≠ F465)
P27338 Amine oxidase [flavin-containing] B; Monoamine oxidase type B; MAO-B; EC 1.4.3.21; EC 1.4.3.4 from Homo sapiens (Human) (see 8 papers)
35% identity, 93% coverage: 33:482/484 of query aligns to 2:452/520 of P27338
- S2 (= S33) modified: N-acetylserine
- C5 (≠ A36) mutation to S: No loss of activity.
- C156 (≠ V189) mutation to S: Complete loss of activity.
- T158 (≠ D191) mutation to A: Dramatic loss of activity.
- C172 (≠ A205) mutation to S: No loss of activity.
- C192 (= C224) mutation to S: No loss of activity.
- C297 (≠ V328) mutation to S: No loss of activity.
- C312 (≠ S343) mutation to S: No loss of activity.
- C365 (≠ L396) mutation to S: Complete loss of activity.
- H382 (≠ F412) mutation to R: Significant loss of activity.
- K386 (≠ M416) mutation to M: No loss of activity.
- C389 (≠ A419) mutation to A: Complete loss of activity.; mutation to S: No loss of activity.
- S394 (≠ T424) mutation to A: No loss of activity.
- C397 (= C427) modified: S-8alpha-FAD cysteine; mutation to S: Complete loss of activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7zw3AAA Amine oxidase [flavin-containing] B (see paper)
35% identity, 93% coverage: 33:482/484 of query aligns to 1:451/500 of 7zw3AAA
- binding 1-(8-oxidanylquinolin-2-yl)-N-(phenylmethyl)methanimine oxide: W118 (vs. gap), L163 (≠ F197), F167 (≠ S201), L170 (≠ Y204), I198 (≠ D231), Q205 (= Q238), Y325 (≠ E355), Y397 (= Y428)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (= D186), K153 (≠ Q187)
- binding flavin-adenine dinucleotide: V9 (= V41), G10 (= G42), G12 (= G44), S14 (≠ A46), L32 (= L64), E33 (= E65), A34 (= A66), R35 (= R67), G40 (= G72), R41 (= R73), G56 (= G88), G57 (= G89), S58 (≠ Q90), Y59 (≠ W91), P233 (= P266), V234 (= V267), I263 (≠ V295), W387 (= W418), Y392 (≠ W423), C396 (= C427), Y397 (= Y428), G424 (= G455), T425 (= T456), G433 (≠ T464), Y434 (≠ F465), M435 (≠ I466)
6yt2A Crystal structure of human monoamine oxidase b in complex with diphenylene iodonium (dpi) (see paper)
35% identity, 93% coverage: 33:482/484 of query aligns to 1:451/500 of 6yt2A
- active site: G61 (= G93), R196 (≠ M229), K295 (= K327)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (= D186), K153 (≠ Q187), W156 (≠ P190)
- binding flavin-adenine dinucleotide: V9 (= V41), G10 (= G42), G12 (= G44), S14 (≠ A46), L32 (= L64), E33 (= E65), A34 (= A66), R35 (= R67), G40 (= G72), R41 (= R73), G56 (= G88), G57 (= G89), S58 (≠ Q90), Y59 (≠ W91), P233 (= P266), V234 (= V267), I263 (≠ V295), W387 (= W418), Y392 (≠ W423), C396 (= C427), Y397 (= Y428), G424 (= G455), T425 (= T456), G433 (≠ T464), Y434 (≠ F465), M435 (≠ I466), A438 (= A469)
- binding benzo[b][1]benziodole: Y59 (≠ W91), L170 (≠ Y204), C171 (≠ A205), I197 (≠ L230), I198 (≠ D231), Q205 (= Q238), Y325 (≠ E355), F342 (= F374)
6fw0A Crystal structure of human monoamine oxidase b (mao b) in complex with chlorophenyl-chromone-carboxamide (see paper)
35% identity, 93% coverage: 33:482/484 of query aligns to 1:451/500 of 6fw0A
- active site: G61 (= G93), R196 (≠ M229), K295 (= K327)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (= D186), K153 (≠ Q187), W156 (≠ P190)
- binding ~{N}-(3-chlorophenyl)-4-oxidanylidene-chromene-3-carboxamide: F167 (≠ S201), L170 (≠ Y204), C171 (≠ A205), I198 (≠ D231), Q205 (= Q238), Y325 (≠ E355), F342 (= F374), Y397 (= Y428)
- binding flavin-adenine dinucleotide: V9 (= V41), G10 (= G42), G12 (= G44), S14 (≠ A46), L32 (= L64), E33 (= E65), A34 (= A66), R35 (= R67), G40 (= G72), R41 (= R73), G56 (= G88), G57 (= G89), S58 (≠ Q90), Y59 (≠ W91), P233 (= P266), V234 (= V267), I263 (≠ V295), W387 (= W418), Y392 (≠ W423), C396 (= C427), Y397 (= Y428), G424 (= G455), T425 (= T456), G433 (≠ T464), Y434 (≠ F465), M435 (≠ I466)
6fvzA Crystal structure of human monoamine oxidase b (mao b) in complex with dimethylphenyl-chromone-carboxamide (see paper)
35% identity, 93% coverage: 33:482/484 of query aligns to 1:451/500 of 6fvzA
- active site: G61 (= G93), R196 (≠ M229), K295 (= K327)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (= D186), W156 (≠ P190)
- binding ~{N}-(3,4-dimethylphenyl)-4-oxidanylidene-chromene-3-carboxamide: F167 (≠ S201), L170 (≠ Y204), I198 (≠ D231), Q205 (= Q238), I315 (= I347), Y325 (≠ E355), F342 (= F374), Y397 (= Y428)
- binding flavin-adenine dinucleotide: V9 (= V41), G10 (= G42), G12 (= G44), S14 (≠ A46), L32 (= L64), E33 (= E65), A34 (= A66), R35 (= R67), G40 (= G72), R41 (= R73), G56 (= G88), G57 (= G89), S58 (≠ Q90), Y59 (≠ W91), P233 (= P266), V234 (= V267), I263 (≠ V295), W387 (= W418), Y392 (≠ W423), C396 (= C427), Y397 (= Y428), G424 (= G455), T425 (= T456), G433 (≠ T464), Y434 (≠ F465), M435 (≠ I466)
7b0zA Crystal structure of human monoamine oxidase b in complex with (e)-3- phenyl-1-(4-(trifluoromethyl)phenyl)prop-2-en-1-one (see paper)
35% identity, 93% coverage: 33:482/484 of query aligns to 1:451/498 of 7b0zA
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (= D186), W156 (≠ P190)
- binding flavin-adenine dinucleotide: V9 (= V41), G10 (= G42), G12 (= G44), S14 (≠ A46), L32 (= L64), E33 (= E65), A34 (= A66), R35 (= R67), G40 (= G72), R41 (= R73), G56 (= G88), G57 (= G89), S58 (≠ Q90), Y59 (≠ W91), P233 (= P266), V234 (= V267), I263 (≠ V295), W387 (= W418), Y392 (≠ W423), C396 (= C427), Y397 (= Y428), G424 (= G455), T425 (= T456), G433 (≠ T464), Y434 (≠ F465), M435 (≠ I466)
- binding (E)-3-phenyl-1-(4-(trifluoromethyl)phenyl)prop-2-en-1-one: Y59 (≠ W91), L170 (≠ Y204), C171 (≠ A205), I198 (≠ D231), Q205 (= Q238), I315 (= I347), Y325 (≠ E355), Y397 (= Y428), Y434 (≠ F465)
7b0vA Crystal structure of human monoamine oxidase b in complex with (e)-3- phenyl-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (see paper)
35% identity, 93% coverage: 33:482/484 of query aligns to 1:451/498 of 7b0vA
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (= D186), K153 (≠ Q187), W156 (≠ P190)
- binding flavin-adenine dinucleotide: V9 (= V41), G10 (= G42), G12 (= G44), S14 (≠ A46), L32 (= L64), E33 (= E65), A34 (= A66), R35 (= R67), G40 (= G72), R41 (= R73), G56 (= G88), G57 (= G89), S58 (≠ Q90), Y59 (≠ W91), V234 (= V267), I263 (≠ V295), W387 (= W418), Y392 (≠ W423), C396 (= C427), Y397 (= Y428), G424 (= G455), T425 (= T456), G433 (≠ T464), Y434 (≠ F465), M435 (≠ I466)
- binding (E)-3-phenyl-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one: W118 (vs. gap), F167 (≠ S201), L170 (≠ Y204), C171 (≠ A205), I198 (≠ D231), Q205 (= Q238), I315 (= I347), Y325 (≠ E355)
3zyxA Crystal structure of human monoamine oxidase b in complex with methylene blue and bearing the double mutation i199a-y326a (see paper)
34% identity, 93% coverage: 34:482/484 of query aligns to 1:450/499 of 3zyxA
- active site: G60 (= G93), R195 (≠ M229), K294 (= K327)
- binding flavin-adenine dinucleotide: G9 (= G42), G11 (= G44), S13 (≠ A46), L31 (= L64), E32 (= E65), A33 (= A66), R34 (= R67), G39 (= G72), R40 (= R73), G55 (= G88), G56 (= G89), S57 (≠ Q90), Y58 (≠ W91), P232 (= P266), V233 (= V267), I262 (≠ V295), W386 (= W418), Y391 (≠ W423), C395 (= C427), Y396 (= Y428), G423 (= G455), T424 (= T456), G432 (≠ T464), Y433 (≠ F465), M434 (≠ I466), A437 (= A469)
- binding 3,7-bis(dimethylamino)phenothiazin-5-ium: L169 (≠ Y204), A197 (≠ D231), Q204 (= Q238), T312 (≠ A345), I314 (= I347), F341 (= F374), Y396 (= Y428)
7p4hA Crystal structure of monoamine oxidase b in complex with inhibitor (+)-2 (see paper)
34% identity, 93% coverage: 34:482/484 of query aligns to 1:450/499 of 7p4hA
- binding 3,4-dimethyl-7-[[(3~{S})-piperidin-3-yl]methoxy]chromen-2-one: Y58 (≠ W91), L169 (≠ Y204), C170 (≠ A205), I197 (≠ D231), Q204 (= Q238), Y324 (≠ E355)
- binding flavin-adenine dinucleotide: G9 (= G42), G11 (= G44), S13 (≠ A46), L31 (= L64), E32 (= E65), A33 (= A66), R34 (= R67), G39 (= G72), R40 (= R73), G55 (= G88), G56 (= G89), S57 (≠ Q90), Y58 (≠ W91), P232 (= P266), V233 (= V267), I262 (≠ V295), W386 (= W418), Y391 (≠ W423), C395 (= C427), Y396 (= Y428), G423 (= G455), T424 (= T456), G432 (≠ T464), Y433 (≠ F465), M434 (≠ I466)
7p4fA Crystal structure of monoamine oxidase b in complex with inhibitor 1 (see paper)
34% identity, 93% coverage: 34:482/484 of query aligns to 1:450/499 of 7p4fA
- binding 4-(hydroxymethyl)-7-[[4-[[methyl-(phenylmethyl)amino]methyl]phenyl]methoxy]chromen-2-one: Y58 (≠ W91), F101 (≠ D135), W117 (vs. gap), L162 (≠ F197), F166 (≠ S201), L169 (≠ Y204), I197 (≠ D231), Q204 (= Q238), Y324 (≠ E355), F341 (= F374), Y396 (= Y428), Y433 (≠ F465)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (= D186), K152 (≠ Q187), W155 (≠ P190)
- binding flavin-adenine dinucleotide: G9 (= G42), G11 (= G44), S13 (≠ A46), E32 (= E65), A33 (= A66), R34 (= R67), G39 (= G72), R40 (= R73), T41 (≠ V74), G55 (= G88), G56 (= G89), S57 (≠ Q90), Y58 (≠ W91), P232 (= P266), V233 (= V267), I262 (≠ V295), W386 (= W418), Y391 (≠ W423), C395 (= C427), Y396 (= Y428), G423 (= G455), T424 (= T456), G432 (≠ T464), Y433 (≠ F465), M434 (≠ I466)
6rleA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 97 (see paper)
34% identity, 93% coverage: 34:482/484 of query aligns to 1:450/499 of 6rleA
- active site: G60 (= G93), R195 (≠ M229), K294 (= K327)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (= D186), W155 (≠ P190)
- binding flavin-adenine dinucleotide: V8 (= V41), G9 (= G42), G11 (= G44), S13 (≠ A46), E32 (= E65), A33 (= A66), R34 (= R67), G39 (= G72), R40 (= R73), G55 (= G88), G56 (= G89), S57 (≠ Q90), Y58 (≠ W91), V233 (= V267), I262 (≠ V295), W386 (= W418), Y391 (≠ W423), C395 (= C427), Y396 (= Y428), G423 (= G455), T424 (= T456), G432 (≠ T464), Y433 (≠ F465), M434 (≠ I466)
- binding 4-[2-(4-propan-2-ylphenyl)ethyl]-1-[(~{E})-prop-1-enyl]piperidine: F166 (≠ S201), L169 (≠ Y204), I197 (≠ D231), Q204 (= Q238), Y324 (≠ E355), Y396 (= Y428)
6rkpA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 84 (see paper)
34% identity, 93% coverage: 34:482/484 of query aligns to 1:450/499 of 6rkpA
- active site: G60 (= G93), R195 (≠ M229), K294 (= K327)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (= D186), W155 (≠ P190)
- binding flavin-adenine dinucleotide: G9 (= G42), G11 (= G44), S13 (≠ A46), E32 (= E65), A33 (= A66), R34 (= R67), G39 (= G72), R40 (= R73), G55 (= G88), G56 (= G89), S57 (≠ Q90), Y58 (≠ W91), P232 (= P266), V233 (= V267), I262 (≠ V295), W386 (= W418), Y391 (≠ W423), C395 (= C427), Y396 (= Y428), G423 (= G455), T424 (= T456), G432 (≠ T464), Y433 (≠ F465), M434 (≠ I466)
- binding 1-[(~{E})-prop-1-enyl]-4-[(~{E})-2-[4-(trifluoromethyl)phenyl]ethenyl]piperidine: P102 (≠ G136), L169 (≠ Y204), I197 (≠ D231), Q204 (= Q238), I314 (= I347), Y324 (≠ E355), F341 (= F374), Y396 (= Y428)
Query Sequence
>Synpcc7942_0369 FitnessBrowser__SynE:Synpcc7942_0369
MKVSRRALLGGAAAVASASVLTRSPRAQAQSKSTRADVVVVGAGYAGLAAAWQLQKAGLK
VVVLEARDRVGGRVWSIDLKGGGWLDLGGQWLGATQDRFAALIQEMGCQTYPTPNFGDTL
YRGVTSSGYYRVKADGSNWESVPGSDLIDEADEKLSAMVDQIDPKAPWQHPQAAIWDGLT
FGQWLDQNVPDANARRFLIASVSYACASPQEISMLQLLFIIRACGGLAMLDGFEGAAQQD
RIIGGAQVVAKRLAERLGSRIQFNQPVRKIRWSDRGVTVFTDQQAIAAQSVVIAVPPTLA
GSIEYEPSLPTDRAQITQRWPQGCVIKVGMVFEEPFWRKDGLSGASIDYGSLVGETADSS
TPPEYSKQGILTGFVYAETARQVLRLSASDRRQQLLASLQGRFGDRILKPVFYQEMNWAM
QPWTKGCYAGYLAPGATYLFKSAVRDPIGPLHWAGTETASQWPTFIDGAIRSGERAAQAI
FSQR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory