SitesBLAST
Comparing Synpcc7942_0950 FitnessBrowser__SynE:Synpcc7942_0950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6dtqA Maltose bound t. Maritima male3 (see paper)
37% identity, 85% coverage: 58:429/438 of query aligns to 16:391/391 of 6dtqA
- binding alpha-D-glucopyranose: R46 (≠ V88), D67 (= D109), D115 (≠ A159), D115 (≠ A159), G166 (= G206), E222 (= E262), W240 (= W280), W240 (= W280), G277 (≠ T317), W278 (= W318), W278 (= W318), Q316 (≠ Y354), R349 (= R387)
- binding magnesium ion: T59 (≠ A101), D60 (≠ P102), D62 (= D104), E290 (≠ H328)
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
33% identity, 92% coverage: 28:430/438 of query aligns to 25:447/450 of Q7LYW7
- E57 (≠ R57) binding
- T84 (≠ N83) binding
- R89 (≠ V88) binding
- D110 (= D109) binding
- Y161 (≠ N157) binding
- D163 (≠ A159) binding
- Y217 (= Y204) binding
- E279 (≠ N263) binding
- W297 (= W280) binding
- Y299 (= Y282) binding
- G334 (≠ T317) binding
- W335 (= W318) binding
- W371 (≠ Y354) binding
- R404 (= R387) binding
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
34% identity, 85% coverage: 58:430/438 of query aligns to 18:406/407 of 1eu8A
- binding alpha-D-glucopyranose: T43 (≠ N83), T45 (= T85), R48 (≠ V88), D69 (= D109), Y120 (≠ N157), D122 (≠ A159), G178 (= G206), E238 (≠ N263), W256 (= W280), Y258 (= Y282), G292 (= G316), G293 (≠ T317), W294 (= W318), R363 (= R387)
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
31% identity, 82% coverage: 75:433/438 of query aligns to 34:403/404 of 6jaiA
- binding calcium ion: P247 (= P281), Y248 (= Y282), R321 (≠ Y354)
- binding alpha-D-glucopyranose: T44 (= T85), D68 (= D109), G173 (= G206), E228 (= E262), W246 (= W280), G283 (= G316), G284 (≠ T317), W285 (= W318), W285 (= W318), R321 (≠ Y354), R354 (= R387)
Sites not aligning to the query:
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
30% identity, 82% coverage: 75:433/438 of query aligns to 34:403/404 of 6jahA
- binding (2S)-heptane-1,2,7-triol: Y309 (≠ A342), E310 (= E343), K313 (≠ R346), R332 (≠ P365)
- binding propane-2,2-diol: D160 (≠ V193), W162 (= W195)
- binding alpha-D-glucopyranose: D68 (= D109), D116 (≠ A159), G173 (= G206), E228 (= E262), W246 (= W280), G283 (= G316), G284 (≠ T317), W285 (= W318), R354 (= R387)
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
30% identity, 82% coverage: 75:433/438 of query aligns to 34:403/404 of 6jagA
- binding beta-D-fructofuranose: R47 (≠ V88), F114 (≠ N157), D116 (≠ A159), E228 (= E262), W246 (= W280), W285 (= W318), R321 (≠ Y354)
- binding alpha-D-glucopyranose: D68 (= D109), D116 (≠ A159), G173 (= G206), E228 (= E262), W246 (= W280), G283 (= G316), G284 (≠ T317), W285 (= W318), R354 (= R387)
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
30% identity, 82% coverage: 75:433/438 of query aligns to 34:403/404 of 6jadA
- binding alpha-D-glucopyranose: D68 (= D109), D116 (≠ A159), G173 (= G206), E228 (= E262), W246 (= W280), G283 (= G316), G284 (≠ T317), W285 (= W318), R354 (= R387)
- binding alpha-D-fructofuranose: R47 (≠ V88), F114 (≠ N157), D116 (≠ A159), Y248 (= Y282), W285 (= W318)
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
30% identity, 82% coverage: 75:433/438 of query aligns to 34:403/404 of 6j9yA
- binding carbonate ion: E373 (≠ H403), K382 (≠ T412), D390 (≠ Q420)
- binding alpha-D-glucopyranose: A42 (≠ N83), R47 (≠ V88), D68 (= D109), D116 (≠ A159), D116 (≠ A159), G173 (= G206), E228 (= E262), W246 (= W280), G283 (= G316), G284 (≠ T317), W285 (= W318), W285 (= W318), R321 (≠ Y354), R354 (= R387)
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
30% identity, 82% coverage: 75:433/438 of query aligns to 36:405/406 of 6jamA
- binding alpha-D-glucopyranose: T46 (= T85), R49 (≠ V88), D70 (= D109), F116 (≠ N157), D118 (≠ A159), D118 (≠ A159), G175 (= G206), E230 (= E262), W248 (= W280), Y250 (= Y282), G285 (= G316), G286 (≠ T317), W287 (= W318), W287 (= W318)
Sites not aligning to the query:
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
30% identity, 82% coverage: 75:433/438 of query aligns to 34:403/404 of 6jb0A
- binding alpha-D-glucopyranose: T44 (= T85), R47 (≠ V88), D68 (= D109), F114 (≠ N157), D116 (≠ A159), D116 (≠ A159), G173 (= G206), E228 (= E262), W246 (= W280), W246 (= W280), Y248 (= Y282), G283 (= G316), G284 (≠ T317), R354 (= R387)
- binding 1,3-propandiol: R318 (≠ G351)
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
26% identity, 84% coverage: 61:428/438 of query aligns to 16:382/382 of 7yzuA
- binding [(2S,3S,4S,5R,6S)-6-methoxy-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T39 (≠ D84), S40 (≠ T85), D64 (= D109), D110 (≠ A159), E162 (= E205), G163 (= G206), T215 (≠ E262), W233 (= W280), G269 (= G316), G270 (≠ T317), W271 (= W318), R340 (= R387)
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
26% identity, 84% coverage: 61:428/438 of query aligns to 47:415/416 of A9CEY9
- S71 (≠ T85) binding
- D95 (= D109) binding
- D141 (≠ A159) binding
- G194 (= G206) binding
- T248 (≠ E262) binding
- G303 (≠ T317) binding ; binding
- W304 (= W318) binding ; binding
- R373 (= R387) binding ; binding
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
26% identity, 84% coverage: 61:428/438 of query aligns to 19:387/389 of 7ofyA
- binding [(2S,3S,4S,5R,6S)-6-[(2R)-2,3-bis(oxidanyl)propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T42 (≠ D84), S43 (≠ T85), D67 (= D109), D113 (≠ A159), G166 (= G206), T220 (≠ E262), W238 (= W280), Y240 (= Y282), G274 (= G316), G275 (≠ T317), W276 (= W318), R345 (= R387)
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
26% identity, 84% coverage: 61:426/438 of query aligns to 17:383/384 of 7yzsAAA
- binding 6-deoxy-6-sulfo-beta-D-glucopyranose: T40 (≠ D84), S41 (≠ T85), D65 (= D109), D111 (≠ A159), E163 (= E205), G164 (= G206), T218 (≠ E262), W236 (= W280), G272 (= G316), G273 (≠ T317), W274 (= W318), R343 (= R387)
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
26% identity, 84% coverage: 61:428/438 of query aligns to 18:385/390 of 7qhvAAA
- binding [(2~{S},3~{S},4~{S},5~{R},6~{S})-6-[(2~{S})-3-butanoyloxy-2-heptanoyloxy-propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: N40 (= N83), T41 (≠ D84), S42 (≠ T85), D66 (= D109), F109 (≠ N157), D111 (≠ A159), E163 (= E205), G164 (= G206), A217 (≠ Q261), T218 (≠ E262), D219 (≠ N263), W236 (= W280), G272 (= G316), G273 (≠ T317), W274 (= W318), R343 (= R387)
Sites not aligning to the query:
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
31% identity, 67% coverage: 104:397/438 of query aligns to 95:434/471 of G7CES0
- D100 (= D109) binding ; mutation to A: Structurally unstable.
- N154 (≠ A159) binding ; mutation to A: About 100-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- Y198 (= Y204) binding
- E261 (= E262) mutation to A: Loss of trehalose-binding.
- W279 (= W280) binding ; mutation to A: Loss of trehalose-binding.
- Y281 (= Y282) binding
- G354 (≠ T317) binding
- L355 (≠ W318) mutation to A: About 13-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- C375 (≠ A338) modified: Disulfide link with 57
- R424 (= R387) binding ; mutation to A: Loss of trehalose-binding.
Sites not aligning to the query:
- 45 binding ; N→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; N→T: Increased trehalose-binding; when associated with D-46.
- 46 binding ; E→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; E→D: Increased trehalose-binding; when associated with T-45.
- 57 modified: Disulfide link with 375
- 79 binding ; Q→A: About 10-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
31% identity, 67% coverage: 104:397/438 of query aligns to 62:401/435 of 7apeA
Sites not aligning to the query:
P9WGU9 Trehalose-binding lipoprotein LpqY; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 69% coverage: 104:405/438 of query aligns to 92:439/468 of P9WGU9
- D97 (= D109) binding
- N151 (≠ A159) binding
- W276 (= W280) binding
- F278 (vs. gap) binding
- G351 (≠ T317) binding
- C372 (≠ A338) modified: Disulfide link with 54
- R421 (= R387) binding
Sites not aligning to the query:
- 54 modified: Disulfide link with 372
8jabA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-06
30% identity, 69% coverage: 104:405/438 of query aligns to 61:408/433 of 8jabA
- binding (2~{S},3~{S},4~{R},5~{S},6~{R})-2-(fluoranylmethyl)-6-[(2~{R},3~{R},4~{S},5~{S},6~{S})-6-(fluoranylmethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-oxane-3,4,5-triol: D66 (= D109), N120 (≠ A159), E165 (= E205), W245 (= W280), F247 (vs. gap), G320 (≠ T317), R390 (= R387)
Sites not aligning to the query:
- binding (2~{S},3~{S},4~{R},5~{S},6~{R})-2-(fluoranylmethyl)-6-[(2~{R},3~{R},4~{S},5~{S},6~{S})-6-(fluoranylmethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-oxane-3,4,5-triol: 9, 11, 12
8jadA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-17
30% identity, 69% coverage: 104:405/438 of query aligns to 61:408/434 of 8jadA
Sites not aligning to the query:
Query Sequence
>Synpcc7942_0950 FitnessBrowser__SynE:Synpcc7942_0950
MPFLRCGLTRWRSLRLLPLLLTLFIVLALGGLGTGTQRSAAADSTVVLRALLPAPFREAM
QPAIARFTAEHPEIQLELVAGPNDTSLVSDLYTTAFLLGNAPYDLVFLDVTWLPKFVAAG
WLLDLSDRVLPEIQAEFLPAALNGSFYRDRLYRLPLNAAVGLLYYRQDLMPEPPQTFTEL
VQRSQQLQAQGVVPWGYVWQGKQYEGLVCNFLEVLAGFGGYWIDPQTGEVGLDHPEAIAA
ADWLHSTITDQISPAGVSTFQENEALKLFETGQSAFMRNWPYAEMLLERPESAVRGKVGI
APMVHAPGQTSAATQGTWGVGIAQQTEHPEAALTALLALTDAESQRLISLGSNYIPTRSA
LYQDPELLARYPFYATLPPILESTVLRSPLPAYDALSDILQRHLSAAISGQTPVAIALQQ
AARESRQLLTSQQGATAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory