SitesBLAST
Comparing Synpcc7942_1665 FitnessBrowser__SynE:Synpcc7942_1665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
27% identity, 97% coverage: 8:367/371 of query aligns to 1:372/372 of 6a3iA
- binding Levoglucosan: K103 (= K102), Y132 (= Y131), Y160 (≠ W159), Q162 (≠ M161), R175 (≠ Y174), D188 (≠ A186), H192 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (= F19), M13 (≠ G20), E42 (≠ H41), A43 (≠ R42), P81 (= P80), N82 (≠ P81), L84 (= L83), H85 (= H84), E102 (= E101), K103 (= K102), W174 (= W173), R175 (≠ Y174)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
27% identity, 97% coverage: 10:368/371 of query aligns to 2:377/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G18), F11 (= F19), M12 (≠ G20), E41 (≠ H41), T79 (≠ S79), P80 (= P80), N81 (≠ P81), H84 (= H84), E101 (= E101), K102 (= K102), W173 (= W173), R174 (≠ Y174)
- binding alpha-L-sorbopyranose: K102 (= K102), Y131 (= Y131), Y159 (≠ W159), Q161 (≠ M161), W163 (≠ S163), R174 (≠ Y174), D187 (≠ A186)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
27% identity, 97% coverage: 8:368/371 of query aligns to 2:389/390 of F0M433
- F13 (= F19) binding
- M14 (≠ G20) binding
- E43 (≠ H41) binding
- T81 (≠ S79) binding
- N83 (≠ P81) binding
- H86 (= H84) binding
- E103 (= E101) binding
- K104 (= K102) binding ; binding
- A130 (≠ D128) binding
- N132 (≠ E130) binding
- Y133 (= Y131) binding
- Q163 (≠ M161) binding
- W175 (= W173) binding
- R176 (≠ Y174) binding ; binding
- D189 (≠ A186) binding
- H193 (= H190) binding
- Y335 (vs. gap) binding
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
34% identity, 71% coverage: 8:270/371 of query aligns to 1:269/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (= K102), Y130 (= Y131), Y158 (≠ W159), E160 (≠ M161), Y162 (≠ S163), D186 (≠ A186), H190 (= H190)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T10 (= T17), G11 (= G18), F12 (= F19), M13 (≠ G20), D40 (≠ H41), M41 (≠ R42), T77 (≠ A78), T78 (≠ S79), N80 (≠ P81), H83 (= H84), E100 (= E101), K101 (= K102), N129 (≠ E130), H190 (= H190)
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
34% identity, 70% coverage: 10:270/371 of query aligns to 2:268/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K100 (= K102), Y129 (= Y131), Y157 (≠ W159), E159 (≠ M161), R172 (≠ Y174), D185 (≠ A186), H189 (= H190)
- binding nicotinamide-adenine-dinucleotide: G8 (= G16), T9 (= T17), G10 (= G18), F11 (= F19), M12 (≠ G20), D39 (≠ H41), M40 (≠ R42), T76 (≠ A78), T77 (≠ S79), N79 (≠ P81), H82 (= H84), E99 (= E101), K100 (= K102), N128 (≠ E130), R172 (≠ Y174), H189 (= H190)
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
34% identity, 70% coverage: 10:270/371 of query aligns to 2:268/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (= K102), Y129 (= Y131), Y157 (≠ W159), E159 (≠ M161), R172 (≠ Y174), D185 (≠ A186), H189 (= H190)
- binding nicotinamide-adenine-dinucleotide: T9 (= T17), G10 (= G18), F11 (= F19), M12 (≠ G20), D39 (≠ H41), M40 (≠ R42), T76 (≠ A78), T77 (≠ S79), P78 (= P80), N79 (≠ P81), H82 (= H84), E99 (= E101), K100 (= K102), N128 (≠ E130), H189 (= H190)
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
32% identity, 71% coverage: 9:270/371 of query aligns to 1:249/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), F11 (= F19), M12 (≠ G20), D33 (≠ H41), L34 (≠ R42), T70 (≠ A78), T71 (≠ S79), P72 (= P80), N73 (≠ P81), L75 (= L83), H76 (= H84), Q79 (≠ M87), E93 (= E101), K94 (= K102), N122 (≠ E130), W161 (= W173), H179 (= H190)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
32% identity, 71% coverage: 9:270/371 of query aligns to 1:249/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (= F19), F152 (≠ W159), N154 (≠ M161), D175 (≠ A186), L176 (= L187), H179 (= H190), E236 (≠ R257)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G18), F11 (= F19), M12 (≠ G20), D33 (≠ H41), L34 (≠ R42), T70 (≠ A78), T71 (≠ S79), P72 (= P80), N73 (≠ P81), L75 (= L83), H76 (= H84), Q79 (≠ M87), E93 (= E101), K94 (= K102), N122 (≠ E130), W161 (= W173), H179 (= H190)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
32% identity, 71% coverage: 9:270/371 of query aligns to 1:249/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (= F19), N154 (≠ M161), D175 (≠ A186), H179 (= H190), E236 (≠ R257)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G16), G10 (= G18), F11 (= F19), M12 (≠ G20), D33 (≠ H41), L34 (≠ R42), T70 (≠ A78), T71 (≠ S79), P72 (= P80), N73 (≠ P81), L75 (= L83), H76 (= H84), Q79 (≠ M87), E93 (= E101), K94 (= K102), N122 (≠ E130), W161 (= W173)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
31% identity, 51% coverage: 10:200/371 of query aligns to 3:190/334 of Q7JK39
- H79 (= H84) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (≠ H190) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
31% identity, 51% coverage: 10:200/371 of query aligns to 3:190/334 of Q9TQS6
- R148 (≠ W153) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
Sites not aligning to the query:
- 202 R→A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
31% identity, 51% coverage: 10:200/371 of query aligns to 2:189/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
31% identity, 51% coverage: 10:200/371 of query aligns to 2:189/331 of 2o4uX
- binding phosphate ion: L2 (= L10), S8 (≠ G16), V9 (≠ T17), A35 (≠ H41), R36 (= R42), R40 (= R46), Y57 (≠ L63), N101 (= N107), A103 (≠ E109), D145 (≠ Q151), R147 (≠ W153), K155 (≠ S162)
Sites not aligning to the query:
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
27% identity, 66% coverage: 24:268/371 of query aligns to 27:258/349 of 6norA
- binding nicotinamide-adenine-dinucleotide: D44 (≠ H41), R45 (= R42), A80 (= A78), T81 (≠ S79), P82 (= P80), H86 (= H84), E103 (= E101), K104 (= K102), N132 (≠ E130), T169 (≠ D166), W171 (= W173)
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
28% identity, 49% coverage: 8:190/371 of query aligns to 2:187/325 of 1zh8A
- active site: K98 (= K102), H187 (= H190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G16), C11 (≠ T17), G12 (= G18), I13 (≠ F19), A14 (≠ G20), S37 (≠ H41), R38 (= R42), T39 (≠ Q43), H42 (≠ R46), T74 (≠ A78), L75 (≠ S79), P76 (= P80), L79 (= L83), E97 (= E101), K98 (= K102), N126 (≠ E130), Y165 (≠ W171), W170 (= W173), R171 (≠ Y174), H187 (= H190)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
25% identity, 54% coverage: 13:211/371 of query aligns to 6:208/340 of 1evjA
- active site: K100 (= K102), Y188 (≠ H190)
- binding nicotinamide-adenine-dinucleotide: G9 (= G16), L10 (≠ T17), G11 (= G18), K12 (vs. gap), Y13 (≠ F19), D35 (≠ H41), L77 (≠ S79), P78 (= P80), N79 (≠ P81), H82 (= H84), E99 (= E101), K100 (= K102), R128 (≠ E130), W170 (≠ Y174), R171 (≠ A175), Y188 (≠ H190)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
25% identity, 54% coverage: 13:211/371 of query aligns to 37:239/383 of 1h6dA
- active site: K131 (= K102), Y219 (≠ H190)
- binding glycerol: K131 (= K102), R202 (≠ A175), D215 (≠ A186), Y219 (≠ H190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G16), L41 (≠ T17), G42 (= G18), K43 (vs. gap), Y44 (≠ F19), S66 (≠ H41), G67 (≠ R42), K71 (≠ R46), Y89 (= Y60), I107 (≠ A78), L108 (≠ S79), P109 (= P80), N110 (≠ P81), H113 (= H84), E130 (= E101), K131 (= K102), R159 (≠ E130), A198 (≠ W171), W201 (≠ Y174), R202 (≠ A175), Y219 (≠ H190)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
25% identity, 54% coverage: 13:211/371 of query aligns to 35:237/381 of 1rydA
- active site: K129 (= K102), Y217 (≠ H190)
- binding alpha-D-glucopyranose: Y236 (≠ F210)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ T17), G40 (= G18), K41 (vs. gap), Y42 (≠ F19), S64 (≠ H41), G65 (≠ R42), K69 (≠ R46), Y87 (= Y60), L106 (≠ S79), P107 (= P80), N108 (≠ P81), L110 (= L83), H111 (= H84), E128 (= E101), K129 (= K102), R157 (≠ E130), A196 (≠ W171), W199 (≠ Y174), R200 (≠ A175), Y217 (≠ H190)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
30% identity, 33% coverage: 36:157/371 of query aligns to 28:149/333 of Q2I8V6
- S33 (≠ H41) mutation to D: No activity.
- ST 33:34 (≠ HR 41:42) binding
- R38 (= R46) binding
- TTNELH 71:76 (≠ SPPFLH 79:84) binding
- EK 93:94 (= EK 101:102) binding
- K94 (= K102) mutation to G: Less than 1% remaining activity.
- N120 (≠ D128) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
30% identity, 33% coverage: 36:157/371 of query aligns to 27:148/332 of 2glxA
Sites not aligning to the query:
Query Sequence
>Synpcc7942_1665 FitnessBrowser__SynE:Synpcc7942_1665
MRHFDASQPLRVAVLGTGFGSKVHIPALQHHSETTVQAVYHRQPDRAAAIAVQFGIPNAY
SDLDQLLADPAIEAVTIASPPFLHYPMAWAALSAGKSVLLEKPTTLNVEEARALWKLASS
QGLTVTLDFEYRFVPAWQYVAELLAEGVIGQPWLVKLDWLMSSRADASRPWNWYALRSQG
GGALGALGSHSFDYLAWLFGPARRLQARLFTAIQERPDATTGELKPVDSDDTDLIQLELA
EGVPCQISLSSVCRQGRGHWLEVYGDRGTLILGSSNQKDYVHGFQVWFASAGQALQELTV
PQRLAFRQEFADGRLAPFLRVVDHWLADLRHGQMTAPSLKEGLYSQLLIDLCWQSQRSGE
WQTVPELNRFL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory