SitesBLAST
Comparing Synpcc7942_1782 FitnessBrowser__SynE:Synpcc7942_1782 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
37% identity, 82% coverage: 64:414/430 of query aligns to 6:348/350 of 2zsjA
- active site: K61 (= K118), T85 (= T142), Q218 (= Q277), A222 (≠ C281), A240 (≠ S306), T317 (= T383)
- binding pyridoxal-5'-phosphate: F60 (= F117), K61 (= K118), N87 (= N144), V186 (≠ L244), G187 (≠ A245), N188 (≠ S246), A189 (≠ G247), G190 (≠ S248), N191 (≠ L249), A240 (≠ S306), T317 (= T383), G318 (= G384)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
36% identity, 76% coverage: 64:388/430 of query aligns to 7:320/350 of 6nmxA
- active site: K60 (= K118), T84 (= T142), E216 (≠ Q277), S220 (≠ C281), A238 (≠ S306), T315 (= T383)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K118), S83 (= S141), T84 (= T142), N86 (= N144), T87 (≠ L145), F133 (≠ Y190), N153 (= N210), S154 (≠ N212), R159 (≠ Y217), V185 (≠ L244), G186 (≠ A245), N187 (≠ S246), A188 (≠ G247), G189 (≠ S248), N190 (≠ L249), A238 (≠ S306), I239 (= I307), E285 (= E353), T315 (= T383)
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
36% identity, 76% coverage: 64:388/430 of query aligns to 5:318/345 of 6cgqB
- active site: K58 (= K118), T82 (= T142), E214 (≠ Q277), S218 (≠ C281), A236 (≠ S306), T313 (= T383)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K118), S81 (= S141), T82 (= T142), N84 (= N144), T85 (≠ L145), V183 (≠ L244), G184 (≠ A245), N185 (≠ S246), A186 (≠ G247), N188 (≠ L249), A236 (≠ S306), I237 (= I307), E283 (= E353), T313 (= T383)
- binding phosphate ion: K58 (= K118), T85 (≠ L145), N151 (= N210), S152 (≠ N212), R157 (≠ Y217), N185 (≠ S246)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
37% identity, 81% coverage: 61:408/430 of query aligns to 3:342/350 of 1uimA
- active site: K61 (= K118), T85 (= T142), P212 (≠ V271), G216 (= G275), Q218 (= Q277), A240 (≠ S306), T317 (= T383)
- binding pyridoxal-5'-phosphate: F60 (= F117), K61 (= K118), N87 (= N144), G187 (≠ A245), N188 (≠ S246), A189 (≠ G247), G190 (≠ S248), N191 (≠ L249), A240 (≠ S306), E287 (= E353), T317 (= T383), G318 (= G384)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
36% identity, 76% coverage: 64:388/430 of query aligns to 3:310/339 of 6cgqA
- active site: K56 (= K118), T80 (= T142), E206 (≠ Q277), S210 (≠ C281), A228 (≠ S306), T305 (= T383)
- binding pyridoxal-5'-phosphate: F55 (= F117), K56 (= K118), N82 (= N144), V175 (≠ L244), G176 (≠ A245), N177 (≠ S246), A178 (≠ G247), G179 (≠ S248), N180 (≠ L249), A228 (≠ S306), E275 (= E353), T305 (= T383), G306 (= G384)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
37% identity, 81% coverage: 61:408/430 of query aligns to 2:341/350 of 3aeyA
- active site: K60 (= K118), T84 (= T142), P211 (≠ V271), G215 (= G275), Q217 (= Q277), A239 (≠ S306), T316 (= T383)
- binding sulfate ion: K60 (= K118), K60 (= K118), G85 (= G143), N86 (= N144), T87 (≠ L145), T87 (≠ L145), S154 (≠ N212), R159 (≠ Y217), N187 (≠ S246), R228 (= R292), V230 (≠ F294), E231 (= E298), R232 (≠ K299), A239 (≠ S306)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
37% identity, 81% coverage: 61:408/430 of query aligns to 3:342/351 of 3aexA
- active site: K61 (= K118), T85 (= T142), P212 (≠ V271), G216 (= G275), Q218 (= Q277), A240 (≠ S306), T317 (= T383)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K118), S84 (= S141), T85 (= T142), N87 (= N144), T88 (≠ L145), V186 (≠ L244), G187 (≠ A245), N188 (≠ S246), A189 (≠ G247), G190 (≠ S248), N191 (≠ L249), A240 (≠ S306), I241 (= I307), E287 (= E353), T317 (= T383)
- binding phosphate ion: K61 (= K118), T88 (≠ L145), N154 (= N210), S155 (≠ N212), R160 (≠ Y217), N188 (≠ S246)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
37% identity, 81% coverage: 61:408/430 of query aligns to 3:342/351 of 1v7cA
- active site: K61 (= K118), T85 (= T142), P212 (≠ V271), G216 (= G275), Q218 (= Q277), A240 (≠ S306), T317 (= T383)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K118), S84 (= S141), T85 (= T142), N87 (= N144), T88 (≠ L145), F134 (≠ Y190), N154 (= N210), S155 (≠ N212), R160 (≠ Y217), V186 (≠ L244), G187 (≠ A245), N188 (≠ S246), A189 (≠ G247), G190 (≠ S248), N191 (≠ L249), A240 (≠ S306), I241 (= I307), E287 (= E353), T317 (= T383)
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 80% coverage: 61:406/430 of query aligns to 13:351/360 of A0R220
- K151 (≠ T203) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
36% identity, 78% coverage: 55:388/430 of query aligns to 7:331/360 of P9WG59
- K69 (= K118) modified: N6-(pyridoxal phosphate)lysine
- N95 (= N144) binding
- K151 (≠ T203) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ ASGSL 245:249) binding
- T326 (= T383) binding
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
36% identity, 76% coverage: 61:388/430 of query aligns to 4:322/349 of 2d1fA
- active site: K60 (= K118), T84 (= T142), D209 (= D267), R213 (= R272), L215 (≠ S274), A240 (≠ S306), T317 (= T383)
- binding pyridoxal-5'-phosphate: F59 (= F117), K60 (= K118), N86 (= N144), V186 (≠ L244), G187 (≠ A245), N188 (≠ S246), A189 (≠ G247), G190 (≠ S248), N191 (≠ L249), A240 (≠ S306), T317 (= T383)
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
28% identity, 82% coverage: 43:396/430 of query aligns to 52:410/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F117), K128 (= K118), D159 (≠ N144), G259 (≠ L244), G260 (≠ A245), N261 (≠ S246), L262 (≠ G247), G263 (≠ S248), N264 (≠ L249), A321 (≠ S306), H369 (≠ A355), T397 (= T383)
- binding s-adenosylmethionine: S64 (≠ A55), T65 (= T56), W66 (≠ I57), P67 (≠ E58), G69 (= G60), S90 (≠ D80), F92 (≠ G82), N97 (≠ P87), L98 (= L88), W100 (≠ E90), W115 (≠ F104), W115 (≠ F104), Q246 (= Q231), F247 (≠ L232)
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 84% coverage: 37:396/430 of query aligns to 109:485/526 of Q9S7B5
- N172 (≠ P87) binding
- L173 (= L88) binding
- K181 (≠ R96) binding in monomer B; binding in monomer A
- N187 (≠ K101) binding in monomer B
- L205 (≠ R120) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
27% identity, 82% coverage: 43:396/430 of query aligns to 70:412/448 of 2c2gA
5ey5B Lbcats
26% identity, 70% coverage: 86:388/430 of query aligns to 51:376/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (≠ S116), K82 (≠ F117), Q109 (≠ N144), S185 (vs. gap), G227 (≠ A245), G229 (= G247), S230 (= S248), N231 (≠ L249), E345 (≠ A355), S371 (≠ T383), G372 (= G384)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
26% identity, 71% coverage: 86:391/430 of query aligns to 67:395/405 of 6u6cB
- active site: K98 (≠ F117), E120 (≠ A140), S387 (≠ T383)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (≠ S116), K98 (≠ F117), T121 (≠ S141), G122 (vs. gap), A123 (≠ T142), Q125 (≠ N144), H126 (≠ L145), T201 (≠ V209), G243 (≠ A245), G245 (= G247), S246 (= S248), N247 (≠ L249), G314 (= G310), E361 (≠ A355), S387 (≠ T383)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: F185 (vs. gap), W188 (≠ L196), Y197 (≠ G205), F199 (≠ G207), G204 (≠ N212), P205 (≠ L213), H291 (= H289), G292 (≠ E290)
Sites not aligning to the query:
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
26% identity, 71% coverage: 86:391/430 of query aligns to 66:394/405 of 6uapB
- active site: K97 (≠ F117), E119 (≠ A140), S386 (≠ T383)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ V193), N181 (= N194), F184 (vs. gap), Y196 (≠ G205), F198 (≠ G207), P204 (≠ L213), F207 (≠ Y216), H290 (= H289)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
26% identity, 71% coverage: 86:391/430 of query aligns to 67:395/406 of 5tciH
Sites not aligning to the query:
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
26% identity, 71% coverage: 86:391/430 of query aligns to 66:394/404 of 6usaB
- active site: K97 (≠ F117), E119 (≠ A140), S386 (≠ T383)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (≠ S116), K97 (≠ F117), T120 (≠ S141), G121 (vs. gap), A122 (≠ T142), G123 (= G143), Q124 (≠ N144), H125 (≠ L145), T200 (≠ V209), G242 (≠ A245), G244 (= G247), S245 (= S248), N246 (≠ L249), G313 (= G310), E360 (≠ A355), S386 (≠ T383)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (vs. gap), W187 (≠ L196), Y196 (≠ G205), F198 (≠ G207), G203 (≠ N212), P204 (≠ L213), F207 (≠ Y216), H290 (= H289), G291 (≠ E290)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
26% identity, 71% coverage: 86:391/430 of query aligns to 66:394/404 of 6dweB
- active site: K97 (≠ F117), E119 (≠ A140), S386 (≠ T383)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (vs. gap), Y196 (≠ G205), F198 (≠ G207), P204 (≠ L213), F207 (≠ Y216), H290 (= H289)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (≠ S116), K97 (≠ F117), T120 (≠ S141), G121 (vs. gap), A122 (≠ T142), G123 (= G143), Q124 (≠ N144), H125 (≠ L145), T200 (≠ V209), G242 (≠ A245), G244 (= G247), S245 (= S248), N246 (≠ L249), G313 (= G310), E360 (≠ A355), S386 (≠ T383)
Query Sequence
>Synpcc7942_1782 FitnessBrowser__SynE:Synpcc7942_1782
MTQTTLSTSTVKALKCKECGHEYDLGAKHVCEDVCFGPLEVVYDYDAIRQRVSRATIEAG
PNSIWRYRHFLPVTGEDVIDVGTGMTPLVEAKRLARRLGLKKLFIKNDAVNMPTLSFKDR
VVSVALTRARELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTLIYN
PTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVAEQLGWQLPDHI
VAPLASGSLFTKIYKGFREFVDVGLVDDKAVRFSGAQAEGCSPIAKAFHEGRDFIAPEKP
NTIAKSIAIGNPADGIYAVEIARKTGGNIEAVNDTEIIEGIKLLAETEGIFTETAGGTTV
AVLKKLVEAGKINPDETTVVYITGNGLKTQEAVQGYIAEPFTIEPKLESFEHALERSRTL
DRLEWQQVLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory