Comparing Synpcc7942_2035 FitnessBrowser__SynE:Synpcc7942_2035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7szeB Structure of the rieske non-heme iron oxygenase gxta with saxitoxin bound (see paper)
33% identity, 93% coverage: 1:322/345 of query aligns to 6:321/329 of 7szeB
7szfA Structure of the rieske non-heme iron oxygenase gxta with beta- saxitoxinol bound (see paper)
33% identity, 93% coverage: 1:322/345 of query aligns to 5:310/318 of 7szfA
6wndA Structure of the rieske non-heme iron oxygenase gxta with dideoxysaxitoxin bound (see paper)
33% identity, 93% coverage: 1:322/345 of query aligns to 5:303/311 of 6wndA
7szgA Structure of the rieske non-heme iron oxygenase gxta pressurized with xenon (see paper)
33% identity, 93% coverage: 1:322/345 of query aligns to 4:307/315 of 7szgA
6icqA Pseudomonas putida cbb5 ndma ql mutant with theobromine (see paper)
30% identity, 94% coverage: 2:325/345 of query aligns to 6:310/334 of 6icqA
6ickA Pseudomonas putida cbb5 ndma (see paper)
29% identity, 94% coverage: 2:325/345 of query aligns to 6:306/330 of 6ickA
6icoA Pseudomonas putida cbb5 ndma with theophylline (see paper)
30% identity, 94% coverage: 2:325/345 of query aligns to 6:320/344 of 6icoA
6icnA Pseudomonas putida cbb5 ndma with caffeine (see paper)
30% identity, 94% coverage: 2:325/345 of query aligns to 6:320/344 of 6icnA
6wnbA Structure of the rieske non-heme iron oxygenase sxtt with dideoxysaxitoxin bound (see paper)
30% identity, 93% coverage: 1:322/345 of query aligns to 5:312/320 of 6wnbA
7szhA Structure of the rieske non-heme iron oxygenase sxtt with beta- saxitoxinol bound (see paper)
31% identity, 93% coverage: 1:322/345 of query aligns to 4:315/323 of 7szhA
6wn3B Structure of the rieske non-heme iron oxygenase sxtt (see paper)
31% identity, 93% coverage: 1:322/345 of query aligns to 6:320/328 of 6wn3B
6iclA Pseudomonas putida cbb5 ndmb (see paper)
29% identity, 92% coverage: 2:317/345 of query aligns to 9:310/338 of 6iclA
3gobA Crystal structure of dicamba monooxygenase with non-heme cobalt and dcsa (see paper)
37% identity, 48% coverage: 2:168/345 of query aligns to 4:168/342 of 3gobA
Sites not aligning to the query:
3gkeA Crystal structure of dicamba monooxygenase (see paper)
37% identity, 48% coverage: 2:168/345 of query aligns to 3:167/340 of 3gkeA
Sites not aligning to the query:
3gb4A Crystal structure of dicamba monooxygenase with non-heme cobalt and dicamba (see paper)
37% identity, 48% coverage: 2:168/345 of query aligns to 3:167/341 of 3gb4A
Sites not aligning to the query:
Q5S3I3 Dicamba O-demethylase, oxygenase component; Dicamba monooxygenase; DMO; Three-component Rieske non-heme iron oxygenase system; EC 1.14.15.- from Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia) (see 3 papers)
37% identity, 48% coverage: 2:168/345 of query aligns to 3:167/339 of Q5S3I3
Sites not aligning to the query:
3gkeB Crystal structure of dicamba monooxygenase (see paper)
37% identity, 48% coverage: 2:168/345 of query aligns to 3:167/334 of 3gkeB
Sites not aligning to the query:
6vshC Crystal structure of apo dicamba monooxygenase (see paper)
37% identity, 46% coverage: 2:158/345 of query aligns to 3:157/320 of 6vshC
P95483 Aminopyrrolnitrin oxygenase PrnD; Arylamine oxygenase; EC 1.14.13.- from Pseudomonas fluorescens (see 2 papers)
30% identity, 60% coverage: 3:209/345 of query aligns to 25:242/363 of P95483
Sites not aligning to the query:
Q9MBA1 Chlorophyllide a oxygenase, chloroplastic; Chlorophyll a oxygenase; Chlorophyll b synthase; AtCAO; EC 1.14.13.122 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 94% coverage: 3:327/345 of query aligns to 217:528/536 of Q9MBA1
Sites not aligning to the query:
>Synpcc7942_2035 FitnessBrowser__SynE:Synpcc7942_2035
MFLKNYWYPVALAQKVGDRPLSVTLCGEAIALYRDSAGQIHALSDRCVHRGAALSGGWVE
NDCLVCPYHGWQYDAQGHCRKIPANTEQQRIPFAAKVPHYDAIERYGLVWLFYGDLPEAD
RPPLPPLPEYDDPAWRTVQGEVTYTTHYTRVTENLMDFAHAPFTHSGSFGAASDPLIEPY
KVEQLPDGLRAQTQFTKSAYRGIWKLFNRGDAPRTVTTTITLYMPCIVRTETDLGNGFRF
IGYGANLPIDAETTKTFWLTVRTFFTGAWADGDTVRRSLKIIEEDKRIVETQRPKMIPLD
DRSETHVAADALQIGYRNLLRQARDRGWAIAESQPADQELVPAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory