SitesBLAST
Comparing WP_011382485.1 NCBI__GCF_000009985.1:WP_011382485.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
23% identity, 99% coverage: 1:315/318 of query aligns to 2:317/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (≠ V12), D32 (≠ V31), N33 (≠ R32), N35 (≠ Q34), Y38 (≠ L37), K43 (≠ E42), D61 (vs. gap), L62 (≠ V50), L83 (= L68), A84 (= A69), A85 (= A70), A118 (≠ L112), Y145 (= Y138), K149 (= K142), F172 (≠ P165), F173 (≠ P166), T174 (≠ L167), V175 (= V168), R181 (≠ K174)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
24% identity, 99% coverage: 1:315/318 of query aligns to 1:306/309 of 4zrnA
- active site: T117 (≠ S114), G119 (vs. gap), A120 (vs. gap), Y143 (= Y138), K147 (= K142), Y181 (vs. gap), G185 (= G175)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), S34 (vs. gap), S35 (≠ A28), G36 (= G29), S51 (≠ C40), I52 (≠ V41), L73 (= L68), A74 (= A69), A75 (= A70), T92 (≠ A89), S115 (≠ L112), S116 (= S113), Y143 (= Y138), K147 (= K142), Y170 (≠ P165), V173 (= V168)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S114), G119 (vs. gap), A120 (vs. gap), Y143 (= Y138), N172 (≠ L167), G185 (= G175), V186 (≠ N176), H201 (≠ P191), F203 (≠ G193), Y208 (≠ N198), R210 (= R200), V244 (≠ T238), R267 (≠ G261), D270 (≠ R264)
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
25% identity, 99% coverage: 1:315/318 of query aligns to 2:301/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (≠ V12), D32 (≠ V31), N33 (≠ R32), N35 (≠ Q34), Y38 (≠ L37), K43 (≠ E42), D61 (vs. gap), L62 (≠ V50), L83 (= L68), A84 (= A69), A85 (= A70), A123 (≠ L112), Y150 (= Y138), K154 (= K142), F177 (≠ P165), V180 (= V168), R186 (≠ K174), M189 (≠ F177)
3aw9A Structure of udp-galactose 4-epimerase mutant
27% identity, 98% coverage: 1:311/318 of query aligns to 1:298/304 of 3aw9A
- active site: A105 (≠ L112), S107 (= S114), S108 (≠ I115), T109 (≠ K116), Y131 (= Y138), K135 (= K142), L166 (vs. gap), G169 (= G172)
- binding galactose-uridine-5'-diphosphate: P69 (≠ V72), V71 (= V74), S107 (= S114), Y131 (= Y138), N160 (≠ L167), H168 (vs. gap), V170 (= V173), D173 (≠ N176), L188 (= L192), Q193 (≠ H197), K195 (≠ R200), Y197 (≠ L202), V234 (≠ T238), W263 (≠ K272), D266 (≠ A275)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (= D39), I32 (≠ C40), R46 (= R48), D47 (≠ L49), L48 (≠ V50), F65 (≠ L68), A66 (= A69), A67 (= A70), E82 (≠ A89), A105 (≠ L112), S106 (= S113), Y131 (= Y138), K135 (= K142), Y158 (≠ P165), N160 (≠ L167), V161 (= V168), H168 (vs. gap)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 98% coverage: 3:313/318 of query aligns to 11:321/667 of Q9LPG6
- G18 (= G10) mutation to A: Abolishes dehydratase activity.
- K36 (≠ A28) mutation to A: Reduces dehydratase activity.
- D96 (= D77) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K142) mutation to A: Abolishes dehydratase activity.
- G193 (= G170) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
34% identity, 66% coverage: 3:212/318 of query aligns to 3:211/299 of 6kv9A
- active site: S110 (= S114), S111 (≠ I115), S112 (≠ K116), Y133 (= Y138), K137 (= K142)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (≠ R32), R32 (≠ G33), R33 (≠ Q34), D47 (≠ L49), L48 (≠ V50), L66 (= L68), A67 (= A69), A68 (= A70), P70 (≠ V72), C85 (≠ A89), A108 (≠ L112), S109 (= S113), K137 (= K142), F162 (≠ P165), T164 (≠ L167), V165 (= V168), R171 (≠ K174), M174 (≠ F177)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ V72), R73 (≠ M75), S110 (= S114), S111 (≠ I115), Y133 (= Y138), T164 (≠ L167), R171 (≠ K174), M174 (≠ F177), F175 (vs. gap), R178 (≠ A179), E190 (≠ P191), I191 (≠ L192), Y192 (≠ G193), Q197 (≠ N198), R199 (= R200)
Sites not aligning to the query:
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
34% identity, 54% coverage: 1:171/318 of query aligns to 1:179/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ V72), R84 (≠ M75), S121 (= S114), G123 (≠ E120), Y146 (= Y138), A174 (≠ P166), N175 (≠ L167)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), A34 (vs. gap), T35 (≠ A28), G36 (= G29), D56 (≠ L49), I57 (≠ V50), L77 (= L68), A78 (= A69), A79 (= A70), I81 (≠ V72), T119 (≠ L112), Y146 (= Y138), K150 (= K142), P173 (= P165), A174 (≠ P166), V176 (= V168)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V72), R84 (≠ M75), S121 (= S114), G123 (≠ E120), Y146 (= Y138), A174 (≠ P166), N175 (≠ L167)
Sites not aligning to the query:
- binding galactose-uridine-5'-diphosphate: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
- binding uridine-5'-diphosphate-glucose: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
34% identity, 54% coverage: 1:171/318 of query aligns to 1:179/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), T35 (≠ A28), G36 (= G29), D56 (≠ L49), I57 (≠ V50), L77 (= L68), A78 (= A69), A79 (= A70), I81 (≠ V72), T119 (≠ L112), Y146 (= Y138), K150 (= K142), P173 (= P165), N175 (≠ L167), V176 (= V168)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ V72), R84 (≠ M75), S121 (= S114), G123 (≠ E120), S124 (≠ E121), Y146 (= Y138), A174 (≠ P166), N175 (≠ L167)
Sites not aligning to the query:
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
34% identity, 54% coverage: 1:171/318 of query aligns to 1:179/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), T35 (≠ A28), G36 (= G29), D56 (≠ L49), I57 (≠ V50), L77 (= L68), A78 (= A69), A79 (= A70), I81 (≠ V72), V96 (vs. gap), T119 (≠ L112), Y146 (= Y138), K150 (= K142), P173 (= P165), A174 (≠ P166), N175 (≠ L167), V176 (= V168)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V72), R84 (≠ M75), S121 (= S114), G123 (≠ E120), Y146 (= Y138), A174 (≠ P166), N175 (≠ L167)
Sites not aligning to the query:
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
25% identity, 98% coverage: 2:313/318 of query aligns to 8:319/669 of Q9SYM5
- R283 (≠ K272) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
34% identity, 66% coverage: 3:212/318 of query aligns to 3:210/299 of 6kvcA
- active site: S109 (= S114), S110 (≠ I115), S111 (≠ K116), Y132 (= Y138), K136 (= K142)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (≠ R32), R32 (≠ G33), R33 (≠ Q34), D46 (≠ R48), L47 (= L49), L65 (= L68), A66 (= A69), A67 (= A70), P69 (≠ V72), A107 (≠ L112), S109 (= S114), K136 (= K142), F161 (≠ P165), T163 (≠ L167), V164 (= V168), R170 (≠ K174), M173 (≠ F177)
- binding uridine-5'-diphosphate-glucose: P69 (≠ V72), R72 (≠ M75), S109 (= S114), S110 (≠ I115), Y132 (= Y138), T163 (≠ L167), M173 (≠ F177), F174 (vs. gap), R177 (≠ A179), E189 (≠ P191), I190 (≠ L192), Y191 (≠ G193), Q196 (≠ N198), R198 (= R200)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
28% identity, 69% coverage: 2:219/318 of query aligns to 2:230/307 of 6wjaA
- active site: A118 (≠ S114), A119 (≠ I115), A120 (≠ K116), F143 (≠ Y138), K147 (= K142)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), D32 (vs. gap), S34 (vs. gap), T35 (≠ A28), G36 (= G29), A55 (≠ L49), L74 (= L68), A75 (= A69), A76 (= A70), S93 (≠ A88), F143 (≠ Y138), K147 (= K142), F170 (≠ P165), F171 (≠ P166), I173 (≠ V168)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ M75), A120 (≠ K116), N172 (≠ L167), G186 (≠ A179), V187 (≠ L180), F191 (≠ V184), T202 (≠ P191), F204 (≠ G193), R211 (= R200)
Sites not aligning to the query:
6x3bA Structure of rmd from pseudomonas aeruginosa complexed with NADPH
28% identity, 99% coverage: 2:316/318 of query aligns to 7:299/300 of 6x3bA
- active site: S108 (= S114), G109 (≠ I115), D110 (≠ K116), Y134 (= Y138), K138 (= K142)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G7), S14 (≠ N9), G15 (= G10), F16 (= F11), V17 (= V12), D42 (= D39), L43 (≠ C40), L63 (= L68), A64 (= A69), G65 (≠ A70), T67 (≠ V72), Y134 (= Y138), K138 (= K142), H164 (≠ V168), Q169 (≠ V173)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
28% identity, 69% coverage: 2:219/318 of query aligns to 3:231/308 of 6wj9B
- active site: A119 (≠ S114), A120 (≠ I115), A121 (≠ K116), F144 (≠ Y138), K148 (= K142)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (≠ V12), D32 (vs. gap), D33 (vs. gap), S35 (vs. gap), T36 (≠ A28), G37 (= G29), D55 (≠ R48), A56 (≠ L49), L75 (= L68), A76 (= A69), A77 (= A70), S94 (≠ A88), A117 (≠ L112), A119 (≠ S114), F144 (≠ Y138), K148 (= K142), F171 (≠ P165), F172 (≠ P166), I174 (≠ V168)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ M75), N173 (≠ L167), G187 (≠ A179), V188 (≠ L180), F192 (≠ V184), T203 (≠ P191), L204 (= L192), F205 (≠ G193), R212 (= R200)
Sites not aligning to the query:
6x3bB Structure of rmd from pseudomonas aeruginosa complexed with NADPH
28% identity, 99% coverage: 2:316/318 of query aligns to 3:296/297 of 6x3bB
- active site: S104 (= S114), G105 (≠ I115), D106 (≠ K116), Y130 (= Y138), K134 (= K142)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), S10 (≠ N9), G11 (= G10), F12 (= F11), V13 (= V12), D38 (= D39), L39 (≠ C40), L59 (= L68), A60 (= A69), G61 (≠ A70), T63 (≠ V72), I102 (≠ L112), Y130 (= Y138), K134 (= K142), H160 (≠ V168), Q165 (≠ V173)
- binding pyrophosphate 2-: D106 (≠ K116), R199 (= R199)
2q1tA Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with NAD+ and udp (see paper)
26% identity, 81% coverage: 2:259/318 of query aligns to 9:275/332 of 2q1tA
- active site: A126 (≠ N118), P141 (= P137), Y142 (= Y138), K146 (= K142), R185 (= R178)
- binding nicotinamide-adenine-dinucleotide: G14 (= G7), G17 (= G10), F18 (= F11), V19 (= V12), D39 (≠ A28), N40 (≠ G29), L41 (≠ A30), S43 (≠ R32), S61 (≠ L49), I62 (≠ V50), L81 (≠ A69), A82 (= A70), T83 (≠ R71), H85 (= H73), N100 (≠ A89), S124 (≠ K116), A126 (≠ N118), Y142 (= Y138), K146 (= K142), F169 (≠ P165), Q170 (≠ P166), N171 (≠ L167), V172 (= V168), R193 (vs. gap)
- binding uridine-5'-diphosphate: N171 (≠ L167), V195 (vs. gap), F199 (≠ L180), P210 (= P191), E212 (≠ G193), R219 (= R200), I254 (≠ T238)
2q1sA Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nadh (see paper)
26% identity, 81% coverage: 2:259/318 of query aligns to 9:275/336 of 2q1sA
- active site: A126 (≠ N118), P141 (= P137), Y142 (= Y138), K146 (= K142), R185 (= R178)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G7), G17 (= G10), F18 (= F11), V19 (= V12), D39 (≠ A28), N40 (≠ G29), L41 (≠ A30), S43 (≠ R32), S61 (≠ L49), I62 (≠ V50), L81 (≠ A69), A82 (= A70), T83 (≠ R71), H85 (= H73), N100 (≠ A89), S124 (≠ K116), Y142 (= Y138), K146 (= K142), F169 (≠ P165), V172 (= V168), R193 (vs. gap)
2pzjA Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with NAD+ (see paper)
26% identity, 81% coverage: 2:259/318 of query aligns to 7:273/330 of 2pzjA
- active site: A124 (≠ N118), P139 (= P137), Y140 (= Y138), K144 (= K142), R183 (= R178)
- binding nicotinamide-adenine-dinucleotide: G12 (= G7), G15 (= G10), F16 (= F11), V17 (= V12), D37 (≠ A28), N38 (≠ G29), L39 (≠ A30), S41 (≠ R32), S59 (≠ L49), I60 (≠ V50), L79 (≠ A69), A80 (= A70), T81 (≠ R71), H83 (= H73), N98 (≠ A89), S122 (≠ K116), Y140 (= Y138), K144 (= K142), F167 (≠ P165), N169 (≠ L167), V170 (= V168), R191 (vs. gap)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
28% identity, 47% coverage: 2:149/318 of query aligns to 3:158/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (≠ F11), I13 (≠ V12), D32 (vs. gap), N33 (≠ G29), S35 (≠ V31), G37 (= G33), D57 (vs. gap), L58 (≠ V50), F79 (≠ L68), A80 (= A69), I83 (≠ V72), N98 (≠ A89), Y147 (= Y138), K151 (= K142)
Sites not aligning to the query:
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
24% identity, 98% coverage: 1:312/318 of query aligns to 1:328/338 of 2udpA
- active site: S124 (= S114), A125 (≠ I115), T126 (≠ K116), Y149 (= Y138), K153 (= K142), M189 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (≠ V12), D31 (= D39), N32 (vs. gap), L33 (vs. gap), C34 (= C40), N35 (≠ V41), S36 (≠ E42), D58 (vs. gap), I59 (vs. gap), F80 (vs. gap), A81 (vs. gap), G82 (vs. gap), K84 (vs. gap), S122 (≠ L112), S124 (= S114), Y149 (= Y138), K153 (= K142), Y177 (≠ V168)
- binding phenyl-uridine-5'-diphosphate: N179 (≠ G170), N199 (= N176), L200 (≠ F177), A216 (≠ G193), I217 (≠ C194), F218 (≠ C195), R231 (= R200), Y233 (≠ L202), V269 (≠ T238), R292 (≠ L265), D295 (≠ G268)
Query Sequence
>WP_011382485.1 NCBI__GCF_000009985.1:WP_011382485.1
MRVLVTGANGFVGQPLCRRLAELGHHVAGAVRGQPYLPDCVERRPAGRLVADGNWSAALE
GMQAVVHLAARVHVMHDASHDPLAEFRAANGAGTLRLAEQAAQAGIGHLVFLSSIKANGE
ETTHTPFGPLNAAPVDPYGISKLEAEQGLAEIAARTGLAVTVLRPPLVYGPGVKGNFRAL
IRLVNRGLPLPLGCCTHNRRSLIGLGNLVDAIRAVLDQPPHPGQCRVFTLCDAEAPSTAD
LVRSLARALGRPARLLPIPVGLMRLGAGLLGKGAAIQRLTASLEVDGSALAAAIGWVPPE
TLDEGLTATARWWRNKES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory