SitesBLAST
Comparing WP_011382582.1 NCBI__GCF_000009985.1:WP_011382582.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
35% identity, 86% coverage: 32:332/352 of query aligns to 38:346/361 of Q9KNV2
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
32% identity, 86% coverage: 44:346/352 of query aligns to 47:342/343 of P56081
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
35% identity, 86% coverage: 32:332/352 of query aligns to 39:345/360 of 3okfA
- active site: R120 (= R109), K142 (= K131), E184 (= E173), K226 (= K214), R238 (= R228), N242 (= N232), H245 (= H235), H249 (= H239), H262 (= H251)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D35), L48 (= L41), D71 (≠ A60), E73 (= E62), K76 (= K65), G104 (= G93), G105 (= G94), V106 (≠ I95), D109 (= D98), T129 (= T118), T130 (= T119), L132 (= L121), D136 (= D125), T172 (= T161), L173 (= L162), E177 (= E166)
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
33% identity, 88% coverage: 33:343/352 of query aligns to 40:363/365 of 3zokA
- active site: R122 (= R109), K144 (= K131), E186 (= E173), K228 (= K214), E238 (≠ D224), R242 (= R228), N246 (= N232), H249 (= H235), H253 (= H239), H266 (= H251)
- binding glycine: K144 (= K131), K228 (= K214), R242 (= R228)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ R37), V45 (= V38), D73 (vs. gap), E75 (= E62), K78 (= K65), G106 (= G93), G107 (= G94), V108 (≠ I95), D111 (= D98), T131 (= T118), T132 (= T119), M134 (≠ L121), D138 (= D125), S139 (= S126), K144 (= K131), K153 (= K140), T174 (= T161), L175 (= L162), E179 (= E166), H266 (= H251)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
33% identity, 88% coverage: 33:343/352 of query aligns to 120:443/445 of U3KRF2
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
37% identity, 84% coverage: 30:326/352 of query aligns to 38:341/363 of 6llaB
- active site: R121 (= R109), K143 (= K131), E185 (= E173), K227 (= K214), E237 (≠ D224), R242 (= R228), N246 (= N232), H249 (= H235), H253 (= H239), H266 (= H251)
- binding magnesium ion: E185 (= E173), H249 (= H235), H266 (= H251)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V38), D72 (≠ N64), E74 (vs. gap), K77 (= K65), G105 (= G93), G106 (= G94), V107 (≠ I95), D110 (= D98), T130 (= T118), T131 (= T119), L133 (= L121), D137 (= D125), K143 (= K131), T173 (= T161), L174 (= L162), E178 (= E166)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
37% identity, 84% coverage: 30:326/352 of query aligns to 38:337/357 of 6lk2A
- active site: R121 (= R109), K143 (= K131), E185 (= E173), K227 (= K214), R238 (= R228), N242 (= N232), H245 (= H235), H249 (= H239), H262 (= H251)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D125), E185 (= E173), K227 (= K214), R238 (= R228), N242 (= N232), H245 (= H235), T246 (≠ S236), H249 (= H239), H262 (= H251)
- binding magnesium ion: E185 (= E173), H245 (= H235), H262 (= H251)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V38), D72 (≠ N64), E74 (vs. gap), K77 (= K65), G105 (= G93), G106 (= G94), V107 (≠ I95), D110 (= D98), T130 (= T118), T131 (= T119), L133 (= L121), D137 (= D125), S138 (= S126), C170 (≠ F158), T173 (= T161), L174 (= L162), P175 (≠ D163), E178 (= E166)
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
40% identity, 53% coverage: 84:271/352 of query aligns to 102:297/381 of 1dqsA
- active site: R127 (= R109), K149 (= K131), E191 (= E173), K240 (= K214), E250 (≠ D224), R254 (= R228), N258 (= N232), H261 (= H235), H265 (= H239), H277 (= H251)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D125), K149 (= K131), N159 (= N141), E191 (= E173), K240 (= K214), R254 (= R228), L257 (≠ F231), N258 (= N232), H261 (= H235), H265 (= H239), H277 (= H251)
- binding nicotinamide-adenine-dinucleotide: G111 (= G93), G112 (= G94), V113 (≠ I95), D116 (= D98), T136 (= T118), T137 (= T119), L139 (= L121), D143 (= D125), S144 (= S126), K158 (= K140), T179 (= T161), P181 (≠ D163), E184 (= E166), H277 (= H251)
- binding zinc ion: E191 (= E173), H261 (= H235), H277 (= H251)
Sites not aligning to the query:
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
32% identity, 80% coverage: 33:313/352 of query aligns to 40:327/359 of Q5NFS1
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
35% identity, 76% coverage: 42:310/352 of query aligns to 53:320/355 of 5eksA
- active site: R120 (= R109), K142 (= K131), E184 (= E173), K226 (= K214), R237 (= R228), N241 (= N232), H244 (= H235), H248 (= H239), H261 (= H251)
- binding magnesium ion: E184 (= E173), H244 (= H235), H261 (= H251)
- binding nicotinamide-adenine-dinucleotide: D71 (≠ A60), E73 (= E62), K76 (= K65), G104 (= G93), G105 (= G94), V106 (≠ I95), D109 (= D98), T129 (= T118), T130 (= T119), D136 (= D125), S137 (= S126), K142 (= K131), T172 (= T161), L173 (= L162), E177 (= E166)
Sites not aligning to the query:
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
33% identity, 79% coverage: 53:330/352 of query aligns to 71:369/385 of 6c5cA
- active site: R130 (= R109), K152 (= K131), E194 (= E173), K246 (= K214), E254 (= E222), R258 (= R228), N262 (= N232), H265 (= H235), H269 (= H239), H281 (= H251)
- binding nicotinamide-adenine-dinucleotide: E83 (vs. gap), K86 (= K65), G114 (= G93), G115 (= G94), V116 (≠ I95), D119 (= D98), T139 (= T118), T140 (= T119), D146 (= D125), S147 (= S126), F179 (= F158), T182 (= T161), L183 (= L162), Q187 (≠ E166)
Sites not aligning to the query:
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
32% identity, 76% coverage: 56:321/352 of query aligns to 67:361/1555 of 6hqvA
- active site: R123 (= R109), K145 (= K131), E187 (= E173), K243 (= K214), E253 (≠ D224), R257 (= R228), N261 (= N232), H264 (= H235), H268 (= H239), H280 (= H251)
- binding glutamic acid: D139 (= D125), K145 (= K131), E187 (= E173), K243 (= K214), R257 (= R228), H264 (= H235), H280 (= H251)
- binding nicotinamide-adenine-dinucleotide: E76 (vs. gap), K79 (= K65), G107 (= G93), G108 (= G94), V109 (≠ I95), D112 (= D98), T132 (= T118), T133 (= T119), L135 (= L121), D139 (= D125), S140 (= S126), K145 (= K131), K154 (= K140), T175 (= T161), L176 (= L162), P177 (≠ D163), E180 (= E166), H280 (= H251)
- binding zinc ion: E187 (= E173), H264 (= H235), H280 (= H251)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
30% identity, 91% coverage: 8:328/352 of query aligns to 25:332/353 of 1xagA
- active site: R115 (= R109), K136 (= K131), E178 (= E173), K221 (= K214), E231 (≠ D224), R235 (= R228), N239 (= N232), H242 (= H235), H246 (= H239), H256 (= H251)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K131), N146 (= N141), E178 (= E173), K221 (= K214), R235 (= R228), L238 (≠ F231), N239 (= N232), H242 (= H235), H246 (= H239), K314 (= K309)
- binding nicotinamide-adenine-dinucleotide: D39 (= D35), Y41 (≠ R37), V42 (= V38), Y45 (≠ L41), E68 (= E62), K71 (= K65), G99 (= G93), G100 (= G94), A101 (≠ I95), D104 (= D98), T124 (= T118), T125 (= T119), L127 (= L121), D130 (= D125), S131 (= S126), K136 (= K131), K145 (= K140), T166 (= T161), L167 (= L162), Q171 (≠ E166), H256 (= H251)
- binding zinc ion: E178 (= E173), H242 (= H235), H256 (= H251)
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
31% identity, 85% coverage: 29:328/352 of query aligns to 32:332/354 of Q6GGU4
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
38% identity, 53% coverage: 84:271/352 of query aligns to 103:305/391 of 1nvbB
- active site: R128 (= R109), K150 (= K131), E192 (= E173), K248 (= K214), E258 (≠ D224), R262 (= R228), N266 (= N232), H269 (= H235), H273 (= H239), H285 (= H251)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D125), K150 (= K131), N160 (= N141), E192 (= E173), K248 (= K214), R262 (= R228), L265 (≠ F231), N266 (= N232), H269 (= H235), H273 (= H239)
- binding zinc ion: E192 (= E173), H269 (= H235), H285 (= H251)
Sites not aligning to the query:
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
38% identity, 53% coverage: 84:271/352 of query aligns to 105:307/1583 of P07547
Sites not aligning to the query:
- 44:46 binding
- 81:84 binding
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
34% identity, 69% coverage: 33:276/352 of query aligns to 43:288/354 of 5hvnA
- active site: R123 (= R109), K145 (= K131), E187 (= E173), K228 (= K214), R239 (= R228), N243 (= N232), H246 (= H235), H250 (= H239), H263 (= H251)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D35), L51 (= L41), D73 (≠ A60), E75 (= E62), K78 (= K65), G107 (= G93), G108 (= G94), V109 (≠ I95), D112 (= D98), T132 (= T118), T133 (= T119), L135 (= L121), D139 (= D125), K145 (= K131), F172 (= F158), T175 (= T161), L176 (= L162), E180 (= E166)
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
33% identity, 69% coverage: 44:286/352 of query aligns to 44:271/308 of 3clhA
- active site: R107 (= R109), K129 (= K131), E171 (= E173), K207 (= K214), R212 (= R228), N216 (= N232), H219 (= H235), H223 (= H239), H236 (= H251)
- binding nicotinamide-adenine-dinucleotide: S58 (≠ A60), E60 (= E62), K63 (= K65), G91 (= G93), G92 (= G94), V93 (≠ I95), D96 (= D98), T116 (= T118), T117 (= T119), L119 (= L121), D123 (= D125), A124 (≠ S126), K129 (= K131), N139 (= N141), T159 (= T161), L160 (= L162), E164 (= E166)
Sites not aligning to the query:
4p53A Vala (2-epi-5-epi-valiolone synthase) from streptomyces hygroscopicus subsp. Jinggangensis 5008 with NAD+ and zn2+ bound (see paper)
33% identity, 73% coverage: 22:277/352 of query aligns to 25:288/360 of 4p53A
- active site: R117 (= R109), K139 (= K131), E181 (= E173), M225 (≠ K214), E235 (≠ D224), R239 (= R228), D243 (≠ N232), H246 (= H235), P250 (≠ H239), H262 (= H251)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D38 (= D35), T40 (≠ R37), V41 (= V38), L44 (= L41), E69 (= E62), K72 (= K65), G101 (= G93), G102 (= G94), V103 (≠ I95), D106 (= D98), T126 (= T118), T127 (= T119), I129 (≠ L121), D133 (= D125), A134 (≠ S126), K148 (= K140), T169 (= T161), L170 (= L162), H174 (≠ E166), H262 (= H251)
- binding zinc ion: E181 (= E173), H246 (= H235), H262 (= H251)
H2K887 2-epi-5-epi-valiolone synthase; EEVS; Sedoheptulose 7-phosphate cyclase; EC 4.2.3.152 from Streptomyces hygroscopicus subsp. jinggangensis (strain 5008) (see paper)
32% identity, 72% coverage: 23:277/352 of query aligns to 58:326/414 of H2K887
Query Sequence
>WP_011382582.1 NCBI__GCF_000009985.1:WP_011382582.1
MTIASHKGPYHVQFDEQGLERLNAAVPADAHFIIDARVAELYRERMGAILAHHSVLLIEA
VEPNKSLECFPAYVQHLVAKGLRRDHLLIAIGGGIIQDITCFLAATMLRGVKWRFYPTTL
LAQCDSCIGSKSSINCGDAKNILGTFTPPNEVVIATTFLDTLDPREVRSGIGEMLKVHAI
SGPEDFTALASRYDRLFTERDAMIATIRRSLEIKKSYIEVDEFDQGPRLVFNLGHSFGHA
IEAATDFAVPHGIAVSMGMDMANWTSWHLGIGTEAHFRTGHGVLAKNYAGYQATPVPLDR
FLAALAKDKKNTGSGSVTLILPDKEGRVFRGVHAADETFRGICARYLAEGRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory