Comparing WP_011382698.1 NCBI__GCF_000009985.1:WP_011382698.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gwgA Crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
82% identity, 100% coverage: 1:341/342 of query aligns to 1:325/329 of 2gwgA
G2IQQ5 2-keto-4-carboxy-3-hexenedioate hydratase; KCH hydratase; EC 4.2.1.- from Sphingobium sp. (strain NBRC 103272 / SYK-6) (see paper)
65% identity, 100% coverage: 1:342/342 of query aligns to 3:341/341 of G2IQQ5
6dxsA Crystal structure of the ligj hydratase e284q mutant substrate complex with (3z)-2-keto-4-carboxy-3-hexenedioate (see paper)
64% identity, 100% coverage: 1:342/342 of query aligns to 2:340/342 of 6dxsA
6dxqA Crystal structure of the ligj hydratase product complex with 4- carboxy-4-hydroxy-2-oxoadipate (see paper)
65% identity, 100% coverage: 2:342/342 of query aligns to 1:338/338 of 6dxqA
5vn5C Crystal structure of ligy from sphingobium sp. Strain syk-6 (see paper)
32% identity, 96% coverage: 1:330/342 of query aligns to 1:328/334 of 5vn5C
6e6iA Crystal structure of 4-methyl hopda bound to ligy from sphingobium sp. Strain syk-6
32% identity, 96% coverage: 1:330/342 of query aligns to 1:328/332 of 6e6iA
4qrnA High-resolution crystal structure of 5-carboxyvanillate decarboxylase (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese and 4-hydroxy-3-methoxy-5-nitrobenzoic acid
24% identity, 88% coverage: 31:330/342 of query aligns to 53:350/352 of 4qrnA
Sites not aligning to the query:
4infA Crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium
24% identity, 88% coverage: 31:330/342 of query aligns to 52:349/351 of 4infA
Sites not aligning to the query:
7pwyC Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
23% identity, 95% coverage: 3:326/342 of query aligns to 2:294/301 of 7pwyC
4ih3A 2.5 angstroms x-ray crystal structure of of human 2-amino-3- carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid (see paper)
24% identity, 95% coverage: 1:326/342 of query aligns to 1:324/332 of 4ih3A
2wm1A The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis (see paper)
24% identity, 95% coverage: 1:326/342 of query aligns to 1:324/332 of 2wm1A
4ofcA 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase (see paper)
24% identity, 95% coverage: 1:326/342 of query aligns to 1:324/335 of 4ofcA
Q8TDX5 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; Picolinate carboxylase; EC 4.1.1.45 from Homo sapiens (Human) (see paper)
24% identity, 95% coverage: 1:326/342 of query aligns to 1:324/336 of Q8TDX5
7pwyA Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
23% identity, 95% coverage: 3:326/342 of query aligns to 2:323/334 of 7pwyA
Q12BV1 Gamma-resorcylate decarboxylase; Gamma-RSD; 2,6-dihydroxybenzoate decarboxylase; 2,6-DHBD; EC 4.1.1.103 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
26% identity, 84% coverage: 45:330/342 of query aligns to 31:322/326 of Q12BV1
Sites not aligning to the query:
4qroA Crystal structure of dihydroxybenzoic acid decarbboxylase bpro_2061 (target efi-500288) from polaromonas sp. Js666 with bound manganese and an inhibitor, 2-nitroresorcinol
26% identity, 84% coverage: 45:330/342 of query aligns to 31:322/332 of 4qroA
Sites not aligning to the query:
4ni8A Crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis complexed with mn and 5-methoxyisophtalic acid
24% identity, 66% coverage: 5:230/342 of query aligns to 20:234/335 of 4ni8A
Sites not aligning to the query:
4ng3A Crystal structure of 5-carboxyvanillate decarboxylase from sphingomonas paucimobilis complexed with 4-hydroxy-3-methoxy-5- nitrobenzoic acid
24% identity, 66% coverage: 5:230/342 of query aligns to 20:234/335 of 4ng3A
Sites not aligning to the query:
4l6dA Crystal structure of 5-carboxyvanillate decarboxylase from sphingomonas paucimobilis complexed with vanillic acid
24% identity, 66% coverage: 5:230/342 of query aligns to 20:234/335 of 4l6dA
Sites not aligning to the query:
4icmA Crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis
24% identity, 66% coverage: 5:230/342 of query aligns to 20:234/335 of 4icmA
Sites not aligning to the query:
>WP_011382698.1 NCBI__GCF_000009985.1:WP_011382698.1
MIIDIHGHYTTAPKALEEWRNRQIAGLKDPAQAPKVSELKISDDELRESIETNQLAKMKE
RGSDLTIFSPRASFMAHHIGDFQTSSTWAAICNELCARVAKLFPDNFIGAAMLPQSPGVD
PKTCIPEIEKCVKEYGFVAINLNPDPSGGHWTSPPLSDRSWYPIYEAMVEYGLPAMVHVS
TSCNACFHTTGAHYLNADTTAFMQCLTSDLFKDFPELKFIIPHGGGAVPYHWGRFRGLAQ
ELKKPLLRDHLLNNIFFDTCVYHQPGIDLLTKVIPVDNILFASEMIGAVRGIDPETGHYY
DDTKRYIEATLNLSPEDRHKVYEGNARRVYPRLDAALKAKGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory