SitesBLAST
Comparing WP_011382978.1 NCBI__GCF_000009985.1:WP_011382978.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 38% coverage: 2:209/553 of query aligns to 16:224/378 of P69874
- C26 (≠ S12) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y13) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F31) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S40) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ V46) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L62) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V120) mutation to M: Loss of ATPase activity and transport.
- D172 (= D157) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 44% coverage: 1:245/553 of query aligns to 1:247/369 of P19566
- L86 (= L83) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P159) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D164) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 44% coverage: 1:245/553 of query aligns to 1:247/371 of P68187
- A85 (≠ S82) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S105) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V113) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ Y116) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ G118) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S123) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G136) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D157) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R226) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ R239) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
38% identity, 44% coverage: 4:245/553 of query aligns to 1:244/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y13), S35 (= S38), G36 (= G39), C37 (≠ S40), G38 (= G41), K39 (= K42), S40 (≠ T43), T41 (= T44), R126 (= R128), A130 (≠ E132), S132 (= S134), G134 (= G136), Q135 (≠ M137)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 44% coverage: 4:245/553 of query aligns to 3:246/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 44% coverage: 4:245/553 of query aligns to 3:246/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y13), S37 (= S38), G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (≠ T43), T43 (= T44), Q81 (= Q79), R128 (= R128), A132 (≠ E132), S134 (= S134), G136 (= G136), Q137 (≠ M137), E158 (= E158), H191 (≠ N191)
- binding magnesium ion: S42 (≠ T43), Q81 (= Q79)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
38% identity, 44% coverage: 4:245/553 of query aligns to 3:246/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y13), G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (≠ T43), T43 (= T44), R128 (= R128), S134 (= S134), Q137 (≠ M137)
- binding beryllium trifluoride ion: S37 (= S38), G38 (= G39), K41 (= K42), Q81 (= Q79), S134 (= S134), G136 (= G136), H191 (≠ N191)
- binding magnesium ion: S42 (≠ T43), Q81 (= Q79)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
38% identity, 44% coverage: 4:245/553 of query aligns to 3:246/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y13), V17 (= V18), G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (≠ T43), T43 (= T44), R128 (= R128), A132 (≠ E132), S134 (= S134), Q137 (≠ M137)
- binding tetrafluoroaluminate ion: S37 (= S38), G38 (= G39), K41 (= K42), Q81 (= Q79), S134 (= S134), G135 (= G135), G136 (= G136), E158 (= E158), H191 (≠ N191)
- binding magnesium ion: S42 (≠ T43), Q81 (= Q79)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
38% identity, 44% coverage: 4:245/553 of query aligns to 3:246/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y13), V17 (= V18), G38 (= G39), C39 (≠ S40), G40 (= G41), K41 (= K42), S42 (≠ T43), T43 (= T44), R128 (= R128), A132 (≠ E132), S134 (= S134), Q137 (≠ M137)
- binding magnesium ion: S42 (≠ T43), Q81 (= Q79)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 38% coverage: 1:209/553 of query aligns to 4:219/375 of 2d62A
1g291 Malk (see paper)
39% identity, 38% coverage: 1:209/553 of query aligns to 1:216/372 of 1g291
- binding magnesium ion: D69 (≠ G69), E71 (≠ G71), K72 (≠ A72), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S38), G39 (= G39), C40 (≠ S40), G41 (= G41), K42 (= K42), T43 (= T43), T44 (= T44)
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 38% coverage: 6:215/553 of query aligns to 6:217/393 of P9WQI3
- H193 (≠ N191) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 37% coverage: 9:215/553 of query aligns to 32:245/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
36% identity, 37% coverage: 9:215/553 of query aligns to 32:245/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
35% identity, 37% coverage: 9:215/553 of query aligns to 32:245/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ S16), S61 (= S38), G62 (= G39), G64 (= G41), K65 (= K42), S66 (≠ T43), T67 (= T44), Q111 (= Q79), K161 (≠ S131), Q162 (≠ E132), S164 (= S134), G166 (= G136), M167 (= M137), Q188 (≠ E158), H221 (≠ N191)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 39% coverage: 293:508/553 of query aligns to 3:216/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y302), S38 (= S331), C40 (= C333), G41 (= G334), K42 (= K335), S43 (= S336), T44 (= T337), Q82 (= Q372), R129 (≠ K421), Q133 (≠ D425), S135 (= S427), G136 (≠ N428), G137 (= G429), Q159 (≠ E451), H192 (= H484)
- binding magnesium ion: S43 (= S336), Q82 (= Q372)
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 39% coverage: 293:508/553 of query aligns to 3:216/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y302), S38 (= S331), G39 (= G332), G41 (= G334), K42 (= K335), S43 (= S336), Q82 (= Q372), Q133 (≠ D425), G136 (≠ N428), G137 (= G429), Q138 (≠ M430), H192 (= H484)
- binding magnesium ion: S43 (= S336), Q82 (= Q372)
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 39% coverage: 295:508/553 of query aligns to 5:214/384 of 8hplC
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 41% coverage: 17:245/553 of query aligns to 9:216/344 of 2awnC
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
38% identity, 40% coverage: 4:225/553 of query aligns to 7:220/353 of 1vciA
Query Sequence
>WP_011382978.1 NCBI__GCF_000009985.1:WP_011382978.1
MPILELKGVAKSYGASSVLRDIDLEIEDGEFIAILGFSGSGKTTLVSLMAGLIKPDAGEV
LLRGKPVDGPGADRGVVFQSYSLMPWLTVEGNIALAVDAVMPDASKAERKARVAKYIGMV
GLSHAAERRPSELSGGMRQRVAVARALAMSPDILLLDEPLSALDALTRAKLQDEIEAIWE
QEKKTVILITNDVDEALLLADRIIPLNPGPGATFGPSFKVNLPRPRDRAAVNSDPDFKRL
RAEVTEYLMAVGVERGGESGETRILPNVAPISFGGPPKAYREAGQVNNPDRYVEFSRVKK
IYPTPKGPLTVVDGFDLKMHQGEFISLIGHSGCGKSTVLTMTAGLTDVSEGGVILDGREV
SEAGPDRAVVFQAPSLFPWLTALQNVALGVDRVYPHASPAERLDIVSYYLERVGLGDSMD
KKASDMSNGMRQRVGIARAFALSPKLLLLDEPFGMLDSLTRWELQEVLMEVWTRTRVTAI
CVTHDVDEAILLADKVVMMTNGPNARIGKVLNVDIPRPRTRRALLEHPRYYEYRAEVLNF
LDEYETGAHAKAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory