SitesBLAST
Comparing WP_011383051.1 NCBI__GCF_000009985.1:WP_011383051.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hcxA Structure of icdh-1 from m.Tuberculosis complexed with NADPH & mn2+ (see paper)
73% identity, 98% coverage: 3:400/406 of query aligns to 2:401/402 of 4hcxA
- binding manganese (ii) ion: D274 (= D273), D278 (= D277)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A73 (= A74), T74 (= T75), T76 (= T77), E305 (= E304), H308 (= H307), G309 (= G308), T310 (= T309), V311 (= V310), R313 (= R312), H314 (= H313), N327 (= N326)
P33198 Isocitrate dehydrogenase [NADP], mitochondrial; IDH; ICD-M; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Sus scrofa (Pig) (see 2 papers)
69% identity, 99% coverage: 2:403/406 of query aligns to 11:419/421 of P33198
- T86 (= T77) binding
- 103:109 (vs. 94:100, 100% identical) binding
- R118 (= R109) binding
- R141 (= R132) binding
- Y148 (= Y139) Critical for catalysis; mutation to F: Large decrease in Vmax and insignificant change in KM for isocitrate and NADP.
- K220 (= K210) Critical for catalysis; mutation K->Q,Y: Large decrease in Vmax and insignificant change in KM for isocitrate and NADP.
- D260 (= D250) binding
- D283 (= D273) binding
6ajcA Crystal structure of trypanosoma cruzi cytosolic isocitrate dehydrogenase in complex with NADP+, isocitrate and ca2+
69% identity, 98% coverage: 2:400/406 of query aligns to 2:406/413 of 6ajcA
- binding calcium ion: D274 (= D273), D278 (= D277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T75 (= T75), I76 (= I76), T77 (= T77), N96 (= N96), D252 (= D251), K259 (= K258), L287 (= L286), A307 (= A306), H308 (= H307), G309 (= G308), T310 (= T309), V311 (= V310), R313 (= R312), H314 (= H313), N327 (= N326)
P48735 Isocitrate dehydrogenase [NADP], mitochondrial; IDH; ICD-M; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Homo sapiens (Human) (see 4 papers)
69% identity, 99% coverage: 3:403/406 of query aligns to 43:450/452 of P48735
- P158 (= P118) to L: in GLM; somatic mutation
- P162 (= P122) to S: in GLM; somatic mutation
- R172 (= R132) to G: in GLM; somatic mutation; reduces enzymatic activity; dbSNP:rs1057519906; to K: in GLM; somatic mutation; reduces enzymatic activity; dbSNP:rs121913503; to M: in GLM; somatic mutation; reduces enzymatic activity; dbSNP:rs121913503; to S: found in patients with cartilagenous tumors; dbSNP:rs1057519736; to T: found in patients with cartilagenous tumors; to W: found in patients with cartilagenous tumors; dbSNP:rs1057519906
- K413 (= K372) modified: N6-acetyllysine; mutation to A: 44-fold loss in activity.; mutation to Q: 20-fold decrease in Vmax.; mutation to R: No appreciable difference in Km for isocitrate and NADP.
5i96A Crystal structure of human mitochondrial isocitrate dehydrogenase (idh2) r140q mutant homodimer in complex with ag-221 (enasidenib) inhibitor. (see paper)
68% identity, 99% coverage: 3:403/406 of query aligns to 3:410/417 of 5i96A
- binding 2-methyl-1-[(4-[6-(trifluoromethyl)pyridin-2-yl]-6-{[2-(trifluoromethyl)pyridin-4-yl]amino}-1,3,5-triazin-2-yl)amino]propan-2-ol: Y271 (= Y270), D272 (= D271), V275 (= V274), Q276 (= Q275), I279 (≠ T278)
- binding calcium ion: D274 (= D273), S277 (= S276)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T75 (= T75), T77 (= T77), E305 (= E304), H308 (= H307), G309 (= G308), T310 (= T309), V311 (= V310), T312 (= T311), R313 (= R312), H314 (= H313), N327 (= N326)
4ja8A Complex of mitochondrial isocitrate dehydrogenase r140q mutant with agi-6780 inhibitor (see paper)
68% identity, 99% coverage: 3:403/406 of query aligns to 3:410/416 of 4ja8A
- binding 1-[5-(cyclopropylsulfamoyl)-2-thiophen-3-yl-phenyl]-3-[3-(trifluoromethyl)phenyl]urea: W124 (= W124), V257 (≠ A256), Y271 (= Y270), D272 (= D271), V275 (= V274), Q276 (= Q275), I279 (≠ T278)
- binding calcium ion: D274 (= D273), D278 (= D277)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T75 (= T75), T77 (= T77), N96 (= N96), H308 (= H307), G309 (= G308), T310 (= T309), V311 (= V310), T312 (= T311), R313 (= R312), H314 (= H313), N327 (= N326)
5svoA Structure of idh2 mutant r140q (see paper)
68% identity, 99% coverage: 3:403/406 of query aligns to 2:409/410 of 5svoA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T74 (= T75), T76 (= T77), H307 (= H307), G308 (= G308), T309 (= T309), V310 (= V310), T311 (= T311), R312 (= R312), H313 (= H313), T325 (= T325), N326 (= N326)
6adiA Crystal structures of idh2 r140q in complex with ag-881 (see paper)
68% identity, 99% coverage: 3:403/406 of query aligns to 3:410/418 of 6adiA
- binding 6-(6-chloropyridin-2-yl)-N2,N4-bis[(2R)-1,1,1-trifluoropropan-2-yl]-1,3,5-triazine-2,4-diamine: V254 (= V253), V257 (≠ A256), D272 (= D271), V275 (= V274), Q276 (= Q275), I279 (≠ T278)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T75 (= T75), I76 (= I76), T77 (= T77), N96 (= N96), E305 (= E304), H308 (= H307), G309 (= G308), T310 (= T309), V311 (= V310), H314 (= H313), T326 (= T325), N327 (= N326)
5i95A Crystal structure of human mitochondrial isocitrate dehydrogenase r140q mutant homodimer bound to NADPH and alpha-ketoglutaric acid (see paper)
68% identity, 99% coverage: 3:403/406 of query aligns to 3:410/413 of 5i95A
- binding 2-oxoglutaric acid: T77 (= T77), S94 (= S94), N96 (= N96), R109 (= R109), D274 (= D273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T75 (= T75), I76 (= I76), T77 (= T77), N96 (= N96), H308 (= H307), G309 (= G308), T310 (= T309), V311 (= V310), T312 (= T311), R313 (= R312), H314 (= H313), N327 (= N326)
5h3eB Crystal structure of mouse isocitrate dehydrogenases 2 k256q mutant complexed with isocitrate (see paper)
68% identity, 99% coverage: 3:403/406 of query aligns to 2:409/410 of 5h3eB
O88844 Isocitrate dehydrogenase [NADP] cytoplasmic; IDH; IDH1; Cytosolic NADP-isocitrate dehydrogenase; IDPc; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Mus musculus (Mouse) (see paper)
66% identity, 100% coverage: 1:405/406 of query aligns to 1:412/414 of O88844
- TIT 75:77 (= TIT 75:77) binding
- T77 (= T77) binding in other chain
- R82 (= R82) binding
- 94:100 (vs. 94:100, 100% identical) binding in other chain
- R109 (= R109) binding in other chain
- R132 (= R132) binding in other chain
- K212 (= K210) binding
- C245 (≠ T243) mutation to S: No effect on inhibition by cadmium ions.
- K260 (= K258) binding
- GTVTRH 310:315 (= GTVTRH 308:313) binding
- N328 (= N326) binding
- C379 (≠ L377) mutation to S: Decreased inhibition by cadmium ions.
5yziA Crystal structure of mouse cytosolic isocitrate dehydrogenase complexed with cadmium (see paper)
67% identity, 98% coverage: 10:405/406 of query aligns to 7:409/409 of 5yziA
- binding cadmium ion: D272 (= D273), D276 (= D277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T72 (= T75), T74 (= T77), N93 (= N96), H306 (= H307), G307 (= G308), T308 (= T309), V309 (= V310), T310 (= T311), R311 (= R312), H312 (= H313), T324 (= T325), N325 (= N326)
1t0lA Crystal structure of human cytosolic NADP(+)-dependent isocitrate dehydrogenase in complex with NADP, isocitrate, and calcium(2+) (see paper)
66% identity, 100% coverage: 1:405/406 of query aligns to 1:412/414 of 1t0lA
- binding calcium ion: D275 (= D273), D279 (= D277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A74 (= A74), T75 (= T75), T77 (= T77), N96 (= N96), D253 (= D251), K260 (= K258), L288 (= L286), H309 (= H307), G310 (= G308), T311 (= T309), V312 (= V310), T313 (= T311), R314 (= R312), H315 (= H313), T327 (= T325), N328 (= N326)
1t09A Crystal structure of human cytosolic NADP(+)-dependent isocitrate dehydrogenase in complex NADP (see paper)
66% identity, 100% coverage: 1:405/406 of query aligns to 1:412/414 of 1t09A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A74 (= A74), T75 (= T75), I76 (= I76), T77 (= T77), R82 (= R82), N96 (= N96), D279 (= D277), S280 (≠ T278), H309 (= H307), G310 (= G308), V312 (= V310), R314 (= R312), T327 (= T325), N328 (= N326)
O75874 Isocitrate dehydrogenase [NADP] cytoplasmic; IDH; IDH1; Cytosolic NADP-isocitrate dehydrogenase; IDPc; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Homo sapiens (Human) (see 6 papers)
66% identity, 100% coverage: 1:405/406 of query aligns to 1:412/414 of O75874
- TIT 75:77 (= TIT 75:77) binding
- T77 (= T77) binding in other chain
- R82 (= R82) binding
- 94:100 (vs. 94:100, 100% identical) binding in other chain
- R109 (= R109) binding in other chain
- R132 (= R132) binding in other chain; to C: in colorectal cancer and glioma samples; glioblastoma multiforme; somatic mutation; found in patients with cartilaginous tumors; abolishes magnesium binding and alters enzyme activity so that isocitrate is no longer converted to alpha-ketoglutarate but instead alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate; induces histone methylation; enhances expression of chondrocyte-related genes; disturbs the formation of cartilaginous matrix; inhibits osteogenic differentiation; dbSNP:rs121913499; to G: in a glioma sample; glioblastoma multiforme; somatic mutation; found in patients with cartilaginous tumors; dbSNP:rs121913499; to H: in a glioma sample; glioblastoma multiforme; somatic mutation; found in patients with cartilaginous tumors; abolishes magnesium binding and alters enzyme activity so that isocitrate is no longer converted to alpha-ketoglutarate but instead alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate; dbSNP:rs121913500; to L: in a glioma sample; glioblastoma multiforme; somatic mutation; abolishes magnesium binding and alters enzyme activity so that isocitrate is no longer converted to alpha-ketoglutarate but instead alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate; dbSNP:rs121913500; to S: in a glioma sample; glioblastoma multiforme; somatic mutation; abolishes magnesium binding and alters enzyme activity so that isocitrate is no longer converted to alpha-ketoglutarate but instead alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate; dbSNP:rs121913499
- K212 (= K210) binding
- K260 (= K258) binding
- GTVTRH 310:315 (= GTVTRH 308:313) binding
- N328 (= N326) binding
5l57A Crystal structure of iso-citrate dehydrogenase r132h in complex with a novel inhibitor (compound 13a) (see paper)
67% identity, 98% coverage: 10:405/406 of query aligns to 8:407/409 of 5l57A
- binding (1~{R},5~{S})-3-[6-(3-methylbutoxy)-5-[[(1~{R},3~{S})-5-oxidanyl-2-adamantyl]carbamoyl]pyridin-2-yl]-3-azabicyclo[3.1.0]hexane-6-carboxylic acid: A109 (≠ P111), R117 (= R119), I128 (= I130), Y280 (≠ F283)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T73 (= T75), D274 (= D277), S275 (≠ T278), L283 (= L286), H304 (= H307), G305 (= G308), T306 (= T309), V307 (= V310), R309 (= R312), H310 (= H313), N323 (= N326)
5yfnA Human isocitrate dehydrogenase 1 bound with isocitrate
66% identity, 99% coverage: 1:403/406 of query aligns to 8:417/418 of 5yfnA
6bkxA Novel modes of inhibition of wild-type idh1: direct covalent modification of his315 with cmpd1 (see paper)
67% identity, 98% coverage: 10:405/406 of query aligns to 8:410/414 of 6bkxA
- binding calcium ion: D273 (= D273), D277 (= D277)
- binding (6aS,7S,9R,10aS)-7,10a-dimethyl-8-oxo-2-(phenylamino)-5,6,6a,7,8,9,10,10a-octahydrobenzo[h]quinazoline-9-carbonitrile: H307 (= H307), V310 (= V310), R312 (= R312), H313 (= H313), S324 (= S324), K372 (= K372), D373 (= D373)
6bl2A Novel modes of inhibition of wild-type idh1: direct covalent modification of his315 with cmpd15 (see paper)
67% identity, 98% coverage: 10:405/406 of query aligns to 8:410/416 of 6bl2A
- binding 3-[(6aS,7S,9S,10aS)-9-cyano-7-methyl-8-oxo-2-(phenylamino)-6,6a,7,8,9,10-hexahydrobenzo[h]quinazolin-10a(5H)-yl]benzoic acid: H307 (= H307), V310 (= V310), R312 (= R312), H313 (= H313), T323 (= T323), K372 (= K372), D373 (= D373), A376 (≠ I376), L381 (vs. gap)
6bl1A Novel modes of inhibition of wild-type idh1: direct covalent modification of his315 with cmpd13 (see paper)
67% identity, 98% coverage: 10:405/406 of query aligns to 8:410/416 of 6bl1A
- binding calcium ion: D273 (= D273), D277 (= D277)
- binding (6aS,7S,9S,10aS)-7-methyl-8-oxo-10a-phenyl-2-(phenylamino)-5,6,6a,7,8,9,10,10a-octahydrobenzo[h]quinazoline-9-carbonitrile: H307 (= H307), V310 (= V310), R312 (= R312), H313 (= H313), M316 (≠ E316), K372 (= K372), L381 (vs. gap)
Query Sequence
>WP_011383051.1 NCBI__GCF_000009985.1:WP_011383051.1
MNKIKVANPIVELDGDEMTRIIWKFIKDKLILPYLDVDLKYYDLGIEYRDKTDDKVTIEA
SEAIKKYGVGVKCATITPDEARVKEFNLKKMWKSPNGTIRNILDGTVFREPIICKNVPRL
VPGWTKPIVIGRHAFGDQYKATDFTVPGPGKLTIKFVGTNGETIEHEVFDFPGAGVAMGM
YNLDESIYGFARACLNYGQQKKWPVYLSTKNTILKAYDGRFKDIFQEVYEKEFKAEYAKL
GITYEHRLIDDMVASALKWSGEFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMSPDGKV
VEAEAAHGTVTRHYREHQKGKETSTNPIASIFAWTRGLFYRAQFDNTPEVAKFAQALEEV
CVETVESGFMTKDLAILIGPGQSWLTTQQFLDKLDENLKKRMGLAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory