Comparing WP_011384016.1 NCBI__GCF_000009985.1:WP_011384016.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 97% coverage: 2:268/275 of query aligns to 35:302/307 of Q94JV5
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
35% identity, 97% coverage: 1:268/275 of query aligns to 1:265/276 of Q9NQR4
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
33% identity, 96% coverage: 5:268/275 of query aligns to 4:299/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
33% identity, 96% coverage: 5:268/275 of query aligns to 4:299/304 of 4hg3A
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 96% coverage: 5:268/275 of query aligns to 7:302/307 of P47016
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
32% identity, 96% coverage: 5:268/275 of query aligns to 3:295/299 of 4hgdA
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
31% identity, 92% coverage: 5:258/275 of query aligns to 2:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
31% identity, 92% coverage: 5:258/275 of query aligns to 2:243/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
31% identity, 92% coverage: 5:258/275 of query aligns to 3:244/262 of Q9UYV8
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
30% identity, 82% coverage: 16:240/275 of query aligns to 22:232/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
30% identity, 82% coverage: 16:240/275 of query aligns to 16:226/263 of 7ovgA
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
25% identity, 93% coverage: 2:258/275 of query aligns to 3:270/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
25% identity, 93% coverage: 2:258/275 of query aligns to 7:274/301 of 5h8iC
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
24% identity, 93% coverage: 2:258/275 of query aligns to 4:271/298 of 5h8lB
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
28% identity, 85% coverage: 28:261/275 of query aligns to 27:249/254 of 4izuA
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
28% identity, 85% coverage: 28:261/275 of query aligns to 35:258/263 of 4iztA
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
28% identity, 85% coverage: 28:261/275 of query aligns to 34:256/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
28% identity, 85% coverage: 28:261/275 of query aligns to 34:256/261 of 4izsA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
28% identity, 85% coverage: 28:261/275 of query aligns to 34:257/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
28% identity, 85% coverage: 28:261/275 of query aligns to 34:257/262 of 5ny7A
Sites not aligning to the query:
>WP_011384016.1 NCBI__GCF_000009985.1:WP_011384016.1
MRGFKAACLQVNASNDLTANCEAAAALAVEARAAGADLILMPENVAMMEWGRSNIVLKAQ
PEEEHLALKFFRDLAREIGAWLHIGSLHVLLEGGMVANRTYVISPDGGIAARYSKIHMFD
VDLGLGEVYKESATFQPGDEAVCVDLPWGRLGLSICYDLRFPHLYRALAHSGSSFLAVPA
AFTRTTGKAHWHVLLRARAIETGCYVFAPAQCGEHVNDRQTYGHALIVSPWGEVLADALE
RPGWVMADIDPEKVKDARRKIPCLDHDRPFGVPKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory