Comparing WP_011384085.1 NCBI__GCF_000009985.1:WP_011384085.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
5exdH Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
27% identity, 86% coverage: 21:184/190 of query aligns to 31:184/291 of 5exdH
Sites not aligning to the query:
>WP_011384085.1 NCBI__GCF_000009985.1:WP_011384085.1
MHEVRLHGRGGQGAVLASAILAAALVEEGRHVMAIPAFGFERRGAPVVAFLRLSDTVIRR
VTNIYSPDIVVVIDPTVVRAVDVYAGMPKGGTLILATSKVPGEIEVPPVVERVAVCNAIT
IAMDIFKRQITNTIMLGAFAKATGLVSVDSLEKALEETHFRDAGLKQNIEAVRRGYAETQ
ILDLAKEKVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory