Comparing WP_011384687.1 NCBI__GCF_000009985.1:WP_011384687.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
29% identity, 86% coverage: 45:336/338 of query aligns to 2:292/294 of Q8UGL3
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 86% coverage: 45:336/338 of query aligns to 2:290/292 of Q07607
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
34% identity, 65% coverage: 48:268/338 of query aligns to 10:224/295 of 3l21B
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
29% identity, 86% coverage: 45:336/338 of query aligns to 2:292/294 of 4i7wA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
33% identity, 65% coverage: 48:268/338 of query aligns to 12:226/297 of 5j5dA
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
33% identity, 65% coverage: 48:268/338 of query aligns to 11:225/296 of 1xxxA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 65% coverage: 48:268/338 of query aligns to 15:229/300 of P9WP25
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
27% identity, 87% coverage: 44:336/338 of query aligns to 1:290/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
27% identity, 87% coverage: 44:336/338 of query aligns to 1:290/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
27% identity, 87% coverage: 44:336/338 of query aligns to 1:290/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
27% identity, 87% coverage: 44:336/338 of query aligns to 1:290/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
27% identity, 87% coverage: 44:336/338 of query aligns to 1:290/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
27% identity, 87% coverage: 44:336/338 of query aligns to 1:290/291 of 3pueB
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
26% identity, 86% coverage: 43:331/338 of query aligns to 3:285/295 of 5ktlA
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
27% identity, 83% coverage: 52:330/338 of query aligns to 9:286/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
27% identity, 83% coverage: 52:330/338 of query aligns to 9:286/296 of 7lvlA
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
29% identity, 66% coverage: 47:270/338 of query aligns to 5:228/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
29% identity, 66% coverage: 47:270/338 of query aligns to 5:228/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 66% coverage: 47:270/338 of query aligns to 5:228/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 66% coverage: 47:270/338 of query aligns to 5:228/298 of 4oe7B
>WP_011384687.1 NCBI__GCF_000009985.1:WP_011384687.1
MAASTAASNMRRRMVVTGLWLPLRAQWSYRPSRQRKRSMSNPGTLDGVLAPILTPFTNAL
TPHVPLFVGLAHHLMGQGLGLAPFGTTSEGNSLGVEEKVELLDALAEIGLNMARVMPGTG
CCALTDSVTLTSHAVNLGCGGVLMLPPFYYKNPSEDGLFASFAEVIERVGDSRLRVYLYH
FPQQSQIPISHGLIERLLAAYPTTVVGIKDSSGDLANMEGMCRAFPGFKVFSGTERLILP
VMRAGGAGCISANANIHGPAMLELWRRWREPQAEALQKDLEGFRAIMEGMPLIAALKALT
ARRTGDYGWRRVRPPLMALPPDAEIELVDRLAKAGIAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory