Comparing WP_011384688.1 NCBI__GCF_000009985.1:WP_011384688.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 79% coverage: 42:261/279 of query aligns to 3:218/229 of 5t0wA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
30% identity, 76% coverage: 49:261/279 of query aligns to 4:216/234 of 3k4uE
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
30% identity, 81% coverage: 41:265/279 of query aligns to 3:229/237 of 5kkwA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
28% identity, 76% coverage: 49:261/279 of query aligns to 4:215/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
26% identity, 76% coverage: 49:261/279 of query aligns to 4:213/225 of 4zv2A
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
25% identity, 78% coverage: 45:261/279 of query aligns to 7:225/240 of 4h5fA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 79% coverage: 42:262/279 of query aligns to 3:218/229 of 6svfA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 6:220/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 10:224/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 10:224/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 10:224/241 of 3vvdA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
23% identity, 54% coverage: 70:219/279 of query aligns to 22:192/254 of 5otaA
Sites not aligning to the query:
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
23% identity, 54% coverage: 70:219/279 of query aligns to 22:192/254 of 5ot9A
Sites not aligning to the query:
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
23% identity, 54% coverage: 70:219/279 of query aligns to 22:192/254 of 4powA
Sites not aligning to the query:
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
23% identity, 54% coverage: 70:219/279 of query aligns to 22:192/256 of 5otcA
Sites not aligning to the query:
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
23% identity, 54% coverage: 70:219/279 of query aligns to 23:193/259 of 5ovzA
Sites not aligning to the query:
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
22% identity, 78% coverage: 45:263/279 of query aligns to 4:223/237 of 4i62A
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
23% identity, 54% coverage: 70:219/279 of query aligns to 23:193/255 of 5itoA
Sites not aligning to the query:
8gu1A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with pimozide (see paper)
25% identity, 69% coverage: 70:261/279 of query aligns to 23:211/234 of 8gu1A
Sites not aligning to the query:
6aalA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with arginine (see paper)
25% identity, 69% coverage: 70:261/279 of query aligns to 23:211/234 of 6aalA
>WP_011384688.1 NCBI__GCF_000009985.1:WP_011384688.1
MWNSIIHPYRRTKMYRFASLIAAFSLLVLGAQPLAAAPGGKLAKIRQAGELRVCIWPDYY
SISYRNTRTGNLEGIDIDMAQELGKDLGVQVRFVDSSFKTMIDDLLSDKCDISMHAVAIT
PARQEKLAFTRPHLRSGIFAITSKTNPVVKEWSDIDRDGVVVAAASGTFMVGVMKEELKK
ARLLEVATPEAREQEVMSGRADLFVTDYPFSRKMLARHDWAKLLTPPTPLAPSPYAYAMA
PGDGEWLDAVDSFVARAKTDGRLLAAAKANGLEAIVDLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory