SitesBLAST
Comparing WP_011385258.1 NCBI__GCF_000009985.1:WP_011385258.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
32% identity, 98% coverage: 1:255/261 of query aligns to 1:269/274 of 4zohB
- active site: Y256 (= Y242)
- binding flavin-adenine dinucleotide: R28 (= R25), P29 (≠ Y26), A31 (= A28), G32 (= G29), G33 (= G30), H34 (≠ Q31), S35 (= S32), L36 (= L33), H77 (= H74), I95 (= I93), G96 (= G94), V100 (= V98), T105 (= T103), G108 (= G106), S109 (≠ A107), S111 (≠ A109), A117 (≠ S115), D118 (= D116), L160 (= L154), V161 (≠ I155), D185 (≠ G177), F186 (≠ Y178)
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
33% identity, 98% coverage: 1:257/261 of query aligns to 1:281/288 of P19920
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
35% identity, 98% coverage: 1:255/261 of query aligns to 1:279/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ R25), L30 (≠ Y26), A32 (= A28), G33 (= G29), G34 (= G30), H35 (≠ Q31), S36 (= S32), L37 (= L33), I54 (= I50), I101 (= I93), A102 (≠ G94), G110 (= G102), T111 (= T103), G114 (= G106), D115 (≠ A107), A117 (= A109), N123 (≠ S115), D124 (= D116), L161 (= L149), V166 (≠ L154), M167 (≠ I155), W193 (≠ Y178)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
34% identity, 98% coverage: 1:255/261 of query aligns to 1:279/287 of 1n5wC
7dqxE Crystal structure of xanthine dehydrogenase family protein
34% identity, 97% coverage: 4:257/261 of query aligns to 6:282/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ R25), I30 (≠ Y26), I31 (≠ L27), G33 (= G29), G34 (= G30), Q35 (= Q31), S36 (= S32), L37 (= L33), H78 (= H74), I101 (= I93), A102 (≠ G94), I106 (≠ V98), G110 (= G102), T111 (= T103), G113 (= G105), G114 (= G106), S115 (≠ A107), A117 (= A109), A123 (≠ S115), E124 (≠ D116), I167 (= I155), Y193 (= Y178)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
38% identity, 62% coverage: 2:163/261 of query aligns to 3:174/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ Y26), A31 (= A28), G32 (= G29), G33 (= G30), Q34 (= Q31), S35 (= S32), L36 (= L33), V100 (≠ I93), A101 (≠ G94), V105 (= V98), T110 (= T103), G113 (= G106), S114 (≠ A107), A116 (= A109), A122 (≠ S115), E123 (≠ D116), L166 (≠ I155)
Sites not aligning to the query:
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
27% identity, 99% coverage: 1:258/261 of query aligns to 1:277/296 of Q0QLF4
- 29:36 (vs. 27:33, 50% identical) binding
- G101 (= G94) binding
- TIGGN 110:114 (≠ TLGGA 103:107) binding
- D123 (= D116) binding
- R160 (≠ E146) binding
- M169 (≠ I155) binding
- K187 (≠ A169) binding
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 99% coverage: 1:258/261 of query aligns to 1:277/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (vs. gap), A31 (= A28), G32 (= G29), G33 (= G30), T34 (≠ Q31), D35 (≠ S32), F77 (≠ H74), V100 (≠ I93), G101 (= G94), I105 (≠ V98), T110 (= T103), G113 (= G106), N114 (≠ A107), S116 (≠ A109), T117 (≠ N110), G122 (≠ S115), D123 (= D116), I168 (≠ L154), M169 (≠ I155)
O33820 4-hydroxybenzoyl-CoA reductase subunit beta; 4-HBCR subunit beta; EC 1.1.7.1 from Thauera aromatica (see paper)
27% identity, 97% coverage: 4:257/261 of query aligns to 7:319/324 of O33820
- 29:36 (vs. 26:33, 38% identical) binding
- T111 (= T103) binding
- N115 (≠ A107) binding
- Q118 (≠ N110) binding
- D162 (vs. gap) binding
- K224 (= K170) binding
1rm6B Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
27% identity, 97% coverage: 4:257/261 of query aligns to 7:319/323 of 1rm6B
- binding flavin-adenine dinucleotide: P29 (≠ Y26), G31 (≠ A28), A32 (≠ G29), G33 (= G30), T34 (≠ Q31), D35 (≠ S32), L36 (= L33), L53 (≠ I50), V101 (≠ I93), A102 (≠ G94), A110 (≠ G102), T111 (= T103), G114 (= G106), N115 (≠ A107), C117 (≠ A109), Q118 (≠ N110), D162 (vs. gap), L207 (≠ I155), V231 (≠ S176), D232 (≠ G177), F233 (≠ Y178)
- binding iron/sulfur cluster: C122 (≠ A114), F124 (≠ D116), C138 (vs. gap), C146 (vs. gap), H147 (vs. gap), V148 (vs. gap), C155 (vs. gap), Y156 (vs. gap), A157 (vs. gap)
5g5gB Escherichia coli periplasmic aldehyde oxidase (see paper)
29% identity, 98% coverage: 1:256/261 of query aligns to 1:308/316 of 5g5gB
- binding flavin-adenine dinucleotide: K26 (≠ R25), F27 (≠ Y26), A29 (= A28), G30 (= G29), G31 (= G30), T32 (≠ Q31), N33 (≠ S32), L34 (= L33), G98 (= G91), A99 (≠ S92), L103 (≠ V98), A107 (≠ G102), T108 (= T103), A110 (≠ G105), G111 (= G106), N112 (≠ A107), L114 (≠ A109), Q115 (≠ N110), S163 (= S115), D164 (= D116), L212 (= L154), I213 (= I155), F239 (≠ Y178)
- binding iron/sulfur cluster: C119 (vs. gap), C129 (vs. gap), N130 (vs. gap), K131 (vs. gap), C138 (vs. gap), H148 (vs. gap), C157 (vs. gap), I158 (vs. gap), A159 (= A111)
P77324 Aldehyde oxidoreductase FAD-binding subunit PaoB; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
29% identity, 98% coverage: 1:256/261 of query aligns to 1:308/318 of P77324
- 26:34 (vs. 25:33, 44% identical) binding
- T108 (= T103) binding
- C119 (vs. gap) binding
- C129 (vs. gap) binding
- C138 (vs. gap) binding
- C157 (vs. gap) binding
- D164 (= D116) binding
- I213 (= I155) binding
- K230 (= K170) binding
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 57% coverage: 23:170/261 of query aligns to 282:447/1361 of Q8GUQ8
- W364 (≠ Q88) mutation to A: Decreases activity 8-fold.
- Y421 (≠ M144) mutation to A: Decreases activity 4-fold.
Sites not aligning to the query:
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
5y6qB Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
25% identity, 99% coverage: 1:259/261 of query aligns to 1:327/330 of 5y6qB
- binding flavin-adenine dinucleotide: I26 (≠ Y26), A28 (= A28), G29 (= G29), G30 (= G30), T31 (≠ Q31), T32 (≠ S32), Q33 (≠ L33), A97 (≠ I93), A98 (≠ G94), I102 (≠ V98), A106 (≠ G102), T107 (= T103), G110 (= G106), N111 (≠ A107), R113 (≠ A109), Q114 (≠ N110), G164 (vs. gap), D165 (vs. gap), I213 (≠ L154), I214 (= I155), K232 (= K170), F241 (vs. gap)
- binding iron/sulfur cluster: C118 (vs. gap), Y121 (vs. gap), C130 (vs. gap), N131 (vs. gap), C139 (vs. gap), A141 (vs. gap), C158 (≠ I128), I159 (vs. gap), A160 (vs. gap)
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
31% identity, 81% coverage: 50:261/261 of query aligns to 213:441/450 of 2w54A
- binding flavin-adenine dinucleotide: L213 (≠ I50), F258 (≠ I93), A259 (≠ G94), A267 (≠ G102), T268 (= T103), G271 (= G106), N272 (≠ A107), A274 (= A109), N275 (= N110), G280 (≠ S115), D281 (= D116), R318 (≠ L149), V324 (≠ I155), Q347 (≠ A175)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 189, 191, 192, 193, 194, 195, 196, 199
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
31% identity, 81% coverage: 50:261/261 of query aligns to 213:441/450 of 1jroA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43, 189, 191, 192, 193, 194, 195, 196
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
2ckjA Human milk xanthine oxidoreductase
25% identity, 55% coverage: 51:194/261 of query aligns to 253:407/1264 of 2ckjA
Sites not aligning to the query:
- active site: 711, 746, 824, 828, 856, 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
26% identity, 48% coverage: 51:176/261 of query aligns to 282:425/1333 of P47989
- F337 (vs. gap) binding
- SVGGN 347:351 (≠ TLGGA 103:107) binding
- D360 (= D116) binding
- K395 (≠ E146) to M: in dbSNP:rs34929837
- K422 (≠ N173) binding
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 703 I → V: in dbSNP:rs17011368
- 763 L → F: in a breast cancer sample; somatic mutation
- 791 R → G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
26% identity, 48% coverage: 51:176/261 of query aligns to 256:399/1307 of 2e1qA
- binding flavin-adenine dinucleotide: F311 (vs. gap), A312 (vs. gap), V316 (= V98), A320 (≠ G102), S321 (≠ T103), G324 (= G106), N325 (≠ A107), I327 (≠ A109), T328 (≠ N110), S333 (= S115), D334 (= D116), I377 (≠ L154), L378 (≠ I155)
Sites not aligning to the query:
- active site: 742, 777, 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 814, 815, 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718, 741, 747, 780, 781, 784, 811, 812
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 719
- binding hydroxy(dioxo)molybdenum: 773, 774, 887, 1053, 1054, 1236
Q06278 Aldehyde oxidase; Aldehyde oxidase 1; Azaheterocycle hydroxylase; EC 1.2.3.1; EC 1.17.3.- from Homo sapiens (Human) (see 3 papers)
26% identity, 54% coverage: 27:168/261 of query aligns to 265:424/1338 of Q06278
- A345 (≠ G94) binding
- S354 (≠ T103) binding
- H358 (≠ A107) binding
- D367 (= D116) binding
- L411 (≠ I155) binding
Sites not aligning to the query:
- 44 binding ; C→W: Disrupts protein stability.
- 49 binding
- 52 binding
- 74 binding
- 113 binding
- 114 binding
- 117 binding
- 149 binding
- 151 binding ; binding
- 264:271 binding
- 802 R → C: decreases homodimerization but nearly no effect on kinetic parameters; dbSNP:rs41309768
- 806:807 binding
- 921 R → H: increases homodimerization; abolishes enzymatic activity on phenanthridine; decreases turnover number with benzaldehyde, phtalazine and chloroquinazolinone as substrate, while nearly no effect on the KM; dbSNP:rs56199635
- 1047 binding
- 1088:1091 binding
- 1135 N → S: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs55754655
- 1203 binding
- 1268 binding
- 1269 G→R: No effect on dimerization. Loss of oxidase activity.
- 1271 S → L: no effect on dimerization; no effect on oxidase activity; dbSNP:rs141786030
- 1297 H → R: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs3731722
Query Sequence
>WP_011385258.1 NCBI__GCF_000009985.1:WP_011385258.1
MFPFDYLRPQSVAEAVCAHDGEERRYLAGGQSLLAALKLRLAQPSALIDIARLPELAGIH
AEAGRLVVGAAVPHAQLAARSTIPALAQLAGSIGDLQVRNMGTLGGALANADPASDHAAG
VLGLGAEIRTDRRVIAAADFFLGMFETALEPGELIVSVSYPLPRRASYAKVRNPASGYPV
VGVLVAETDDGIRVAVTGAASCPFRLTEFEMALAGDFSPAALEGLTVPVDDLSRDLHASA
EYRAALIPVLARRALAQGGGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory