Comparing WP_011386296.1 NCBI__GCF_000009985.1:WP_011386296.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3touA Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
33% identity, 86% coverage: 11:201/223 of query aligns to 11:197/212 of 3touA
Sites not aligning to the query:
4mk3A Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
32% identity, 89% coverage: 4:201/223 of query aligns to 3:196/203 of 4mk3A
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
28% identity, 90% coverage: 1:201/223 of query aligns to 2:191/204 of 4qq7A
Q12390 Glutathione S-transferase 2; GST-II; EC 2.5.1.18 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 91% coverage: 4:205/223 of query aligns to 21:226/233 of Q12390
3ibhA Crystal structure of saccharomyces cerevisiae gtt2 in complex with glutathione (see paper)
30% identity, 91% coverage: 4:205/223 of query aligns to 3:208/208 of 3ibhA
3ergA Crystal structure of gtt2 from saccharomyces cerevisiae in complex with glutathione sulfnate (see paper)
30% identity, 91% coverage: 4:205/223 of query aligns to 3:208/208 of 3ergA
4gltA Crystal structure of glutathione s-transferase mfla_2116 (target efi- 507160) from methylobacillus flagellatus kt with gsh bound
29% identity, 91% coverage: 1:202/223 of query aligns to 7:202/208 of 4gltA
4hojA Crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione
28% identity, 89% coverage: 3:201/223 of query aligns to 2:184/197 of 4hojA
3pr8A Structure of glutathione s-transferase(pp0183) from pseudomonas putida in complex with gsh
25% identity, 94% coverage: 4:213/223 of query aligns to 4:209/218 of 3pr8A
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
28% identity, 72% coverage: 38:197/223 of query aligns to 40:188/207 of 1jlvA
Sites not aligning to the query:
4ielB Crystal structure of a glutathione s-transferase family protein from burkholderia ambifaria, target efi-507141, with bound glutathione
30% identity, 60% coverage: 39:172/223 of query aligns to 41:169/206 of 4ielB
Sites not aligning to the query:
3qagA Human glutathione transferase o2 with glutathione -new crystal form (see paper)
25% identity, 91% coverage: 4:207/223 of query aligns to 25:218/238 of 3qagA
4nhzH Crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., Target efi-507290, with one glutathione bound
28% identity, 89% coverage: 4:202/223 of query aligns to 35:237/246 of 4nhzH
4g9hA Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione
27% identity, 92% coverage: 1:206/223 of query aligns to 3:198/202 of 4g9hA
5zwpA Crystal structure of the delta-class glutathione transferase from musca domestica (see paper)
27% identity, 72% coverage: 38:197/223 of query aligns to 40:188/207 of 5zwpA
Sites not aligning to the query:
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
26% identity, 87% coverage: 4:198/223 of query aligns to 3:189/209 of 1pn9A
Sites not aligning to the query:
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
42% identity, 31% coverage: 16:85/223 of query aligns to 17:89/216 of 4pxoA
Sites not aligning to the query:
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
31% identity, 71% coverage: 41:199/223 of query aligns to 45:194/201 of 3m3mA
Sites not aligning to the query:
Q9H4Y5 Glutathione S-transferase omega-2; GSTO-2; Glutathione S-transferase omega 2-2; GSTO 2-2; Glutathione-dependent dehydroascorbate reductase; Monomethylarsonic acid reductase; MMA(V) reductase; EC 2.5.1.18; EC 1.8.5.1; EC 1.20.4.2 from Homo sapiens (Human) (see 2 papers)
25% identity, 91% coverage: 4:207/223 of query aligns to 26:219/243 of Q9H4Y5
6wegD Structure of ft (mgla-sspa)-ppgpp-pigr peptide complex (see paper)
25% identity, 91% coverage: 1:202/223 of query aligns to 3:190/194 of 6wegD
>WP_011386296.1 NCBI__GCF_000009985.1:WP_011386296.1
MRTLYHHPLCPFSRLVRIVLAEKKLDFEPQIEKTWERRPEFLALNPAGVLPVLVEEDGAA
LADATAIVEYLEETSRETPLLPAEPLARAEVRRLVAWFGQKFHAEVTDHLVGEKVFKRLE
SGRNEPDSRRIRAGFGNIHRHLDYLGTLTERHGYLAGGAFTLADIAAAAQISAVDYLGDV
PWDQHAPAKDWYARVKSRPSFRVLLADHLPGLPPPRHYANPDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory