Comparing WP_011386686.1 NCBI__GCF_000009985.1:WP_011386686.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x40A Structure of a cbio dimer bound with amppcp (see paper)
48% identity, 90% coverage: 7:214/232 of query aligns to 8:219/280 of 5x40A
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
36% identity, 91% coverage: 4:214/232 of query aligns to 3:224/280 of Q5M244
8bmpB Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
35% identity, 91% coverage: 4:214/232 of query aligns to 2:223/281 of 8bmpB
5d3mB Folate ecf transporter: amppnp bound state (see paper)
35% identity, 91% coverage: 4:214/232 of query aligns to 2:223/281 of 5d3mB
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
35% identity, 84% coverage: 2:196/232 of query aligns to 4:202/278 of 8bmpA
8bmsB Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
34% identity, 91% coverage: 4:214/232 of query aligns to 2:223/281 of 8bmsB
5d3mA Folate ecf transporter: amppnp bound state (see paper)
34% identity, 84% coverage: 2:196/232 of query aligns to 4:205/280 of 5d3mA
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 92% coverage: 1:213/232 of query aligns to 1:215/276 of Q5M243
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
34% identity, 84% coverage: 2:196/232 of query aligns to 3:202/278 of 8bmsA
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
34% identity, 90% coverage: 4:212/232 of query aligns to 3:215/265 of 4hluA
D5ARH0 Biotin transport ATP-binding protein BioM; ECF transporter A component BioM; EC 7.6.2.- from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
40% identity, 78% coverage: 32:213/232 of query aligns to 30:208/234 of D5ARH0
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 86% coverage: 3:201/232 of query aligns to 1:206/240 of 4ymuJ
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
34% identity, 90% coverage: 4:212/232 of query aligns to 3:213/263 of 4zirA
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
36% identity, 86% coverage: 17:215/232 of query aligns to 16:218/223 of 2pclA
8g4cB Bceabs atpgs high res tm (see paper)
38% identity, 76% coverage: 19:194/232 of query aligns to 22:203/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
37% identity, 77% coverage: 17:194/232 of query aligns to 19:202/245 of 7tchB
Sites not aligning to the query:
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
35% identity, 92% coverage: 3:215/232 of query aligns to 1:217/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
35% identity, 92% coverage: 3:215/232 of query aligns to 1:217/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
34% identity, 92% coverage: 3:215/232 of query aligns to 1:217/218 of 8hd0A
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 99% coverage: 3:231/232 of query aligns to 84:332/345 of Q9AT00
>WP_011386686.1 NCBI__GCF_000009985.1:WP_011386686.1
MTLIRLEQVTHAFDTTHPVLDGVDFQLGKGERVALLGANGSGKTTLLHVMVGLIRPKAGT
VHAFGRERRAEADFVEVRAKAGLLFQDADDQLFCPTVAEDVAFGPLNLGKSKAEAREIVH
AVLARLGLAALEDRVTHKLSGGQKRLVSLAAVLAMEPDALLLDEPTNALDEATRERLLDI
LAGLPQAMVIVSHDREVIERLATRRVTLAGGRLLGCRPNPPGANAPDPIFES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory