SitesBLAST
Comparing WP_043745113.1 NCBI__GCF_000009985.1:WP_043745113.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
43% identity, 99% coverage: 4:344/344 of query aligns to 6:355/362 of 3bptA
- active site: G67 (= G65), P84 (≠ A83), R88 (= R87), G115 (= G114), G118 (= G117), E138 (= E137), D146 (= D145)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G64), G67 (= G65), I69 (= I67), E90 (= E89), G114 (= G113), G115 (= G114), E138 (= E137), D146 (= D145), V147 (= V146)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ A23), L26 (= L24), A28 (= A26), G66 (= G64), G67 (= G65), I69 (= I67), P137 (= P136), I141 (= I140), L319 (= L311)
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 96% coverage: 16:344/344 of query aligns to 22:364/378 of Q9LKJ1
- G70 (= G65) mutation to S: Loss of activity.
- E142 (= E137) mutation to A: Loss of activity.
- D150 (= D145) mutation to G: Reduced activity.
4hdtA Crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile (see paper)
43% identity, 97% coverage: 11:344/344 of query aligns to 10:337/340 of 4hdtA
- active site: G64 (= G65), I69 (≠ L70), W84 (≠ Y86), Y88 (= Y90), G112 (= G114), G115 (= G117), E135 (= E137), P142 (= P144), D143 (= D145), R283 (≠ K288)
- binding zinc ion: H28 (≠ L29), E42 (≠ A43), E57 (= E58), E79 (= E80), H93 (≠ R95), H185 (≠ S187)
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
31% identity, 57% coverage: 5:199/344 of query aligns to 6:196/259 of 5zaiC
- active site: A65 (≠ G65), F70 (≠ L70), S82 (≠ Y86), R86 (≠ Y90), G110 (= G114), E113 (≠ G117), P132 (= P136), E133 (= E137), I138 (≠ F142), P140 (= P144), G141 (≠ D145)
- binding coenzyme a: K24 (≠ A23), L25 (= L24), A63 (= A63), G64 (= G64), A65 (≠ G65), D66 (= D66), I67 (= I67), P132 (= P136), R166 (= R169)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 69% coverage: 5:240/344 of query aligns to 6:221/255 of 3q0jC
- active site: A65 (≠ G65), M70 (≠ L70), T80 (≠ Y86), F84 (≠ Y90), G108 (= G114), E111 (≠ G117), P130 (= P136), E131 (= E137), V136 (≠ F142), P138 (= P144), G139 (≠ D145)
- binding acetoacetyl-coenzyme a: Q23 (≠ K22), A24 (= A23), L25 (= L24), A27 (= A26), A63 (= A63), G64 (= G64), A65 (≠ G65), D66 (= D66), I67 (= I67), K68 (= K68), M70 (≠ L70), F84 (≠ Y90), G107 (= G113), G108 (= G114), E111 (≠ G117), P130 (= P136), E131 (= E137), P138 (= P144), G139 (≠ D145), M140 (≠ V146)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 69% coverage: 5:240/344 of query aligns to 6:221/255 of 3q0gC
- active site: A65 (≠ G65), M70 (≠ L70), T80 (≠ Y86), F84 (≠ Y90), G108 (= G114), E111 (≠ G117), P130 (= P136), E131 (= E137), V136 (≠ F142), P138 (= P144), G139 (≠ D145)
- binding coenzyme a: L25 (= L24), A63 (= A63), I67 (= I67), K68 (= K68), Y104 (≠ I110), P130 (= P136), E131 (= E137), L134 (≠ I140)
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 69% coverage: 5:240/344 of query aligns to 5:220/256 of 3h81A
- active site: A64 (≠ G65), M69 (≠ L70), T79 (≠ Y86), F83 (≠ Y90), G107 (= G114), E110 (≠ G117), P129 (= P136), E130 (= E137), V135 (≠ F142), P137 (= P144), G138 (≠ D145)
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
32% identity, 51% coverage: 9:184/344 of query aligns to 12:176/254 of 2dubA
- active site: A67 (≠ G65), M72 (≠ L70), S82 (≠ R91), G105 (= G114), E108 (≠ G117), P127 (= P136), E128 (= E137), T133 (≠ F142), P135 (= P144), G136 (≠ D145)
- binding octanoyl-coenzyme a: K25 (= K22), A26 (= A23), L27 (= L24), A29 (= A26), A65 (= A63), A67 (≠ G65), D68 (= D66), I69 (= I67), K70 (= K68), G105 (= G114), E108 (≠ G117), P127 (= P136), E128 (= E137), G136 (≠ D145), A137 (≠ V146)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
31% identity, 69% coverage: 5:240/344 of query aligns to 5:216/250 of 3q0gD
- active site: A64 (≠ G65), M69 (≠ L70), T75 (≠ Y86), F79 (≠ Y90), G103 (= G114), E106 (≠ G117), P125 (= P136), E126 (= E137), V131 (≠ F142), P133 (= P144), G134 (≠ D145)
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
32% identity, 51% coverage: 9:184/344 of query aligns to 43:212/290 of P14604
- E144 (≠ G117) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E137) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
32% identity, 51% coverage: 9:184/344 of query aligns to 13:182/260 of 1dubA
- active site: A68 (≠ G65), M73 (≠ L70), S83 (≠ A76), L87 (≠ R87), G111 (= G114), E114 (≠ G117), P133 (= P136), E134 (= E137), T139 (≠ F142), P141 (= P144), G142 (≠ D145)
- binding acetoacetyl-coenzyme a: K26 (= K22), A27 (= A23), L28 (= L24), A30 (= A26), A66 (= A63), A68 (≠ G65), D69 (= D66), I70 (= I67), Y107 (≠ I110), G110 (= G113), G111 (= G114), E114 (≠ G117), P133 (= P136), E134 (= E137), L137 (≠ I140), G142 (≠ D145)
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
32% identity, 51% coverage: 9:184/344 of query aligns to 13:182/260 of 2hw5C
- active site: A68 (≠ G65), M73 (≠ L70), S83 (≠ Y86), L87 (≠ Y90), G111 (= G114), E114 (≠ G117), P133 (= P136), E134 (= E137), T139 (≠ F142), P141 (= P144), G142 (≠ D145)
- binding crotonyl coenzyme a: K26 (= K22), A27 (= A23), L28 (= L24), A30 (= A26), K62 (= K59), I70 (= I67), F109 (≠ M112)
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
32% identity, 51% coverage: 9:184/344 of query aligns to 11:180/258 of 1ey3A
- active site: A66 (≠ G65), M71 (≠ L70), S81 (≠ A76), L85 (≠ R87), G109 (= G114), E112 (≠ G117), P131 (= P136), E132 (= E137), T137 (≠ F142), P139 (= P144), G140 (≠ D145)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (= K22), L26 (= L24), A28 (= A26), A64 (= A63), G65 (= G64), A66 (≠ G65), D67 (= D66), I68 (= I67), L85 (≠ R87), W88 (≠ Y90), G109 (= G114), P131 (= P136), L135 (≠ I140), G140 (≠ D145)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
32% identity, 51% coverage: 9:184/344 of query aligns to 13:180/258 of 1mj3A
- active site: A68 (≠ G65), M73 (≠ L70), S83 (≠ A76), L85 (= L92), G109 (= G114), E112 (≠ G117), P131 (= P136), E132 (= E137), T137 (≠ F142), P139 (= P144), G140 (≠ D145)
- binding hexanoyl-coenzyme a: K26 (= K22), A27 (= A23), L28 (= L24), A30 (= A26), A66 (= A63), G67 (= G64), A68 (≠ G65), D69 (= D66), I70 (= I67), G109 (= G114), P131 (= P136), E132 (= E137), L135 (≠ I140), G140 (≠ D145)
Sites not aligning to the query:
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
32% identity, 55% coverage: 16:205/344 of query aligns to 16:198/257 of 6slbAAA
- active site: Q64 (≠ G65), F69 (≠ L70), L80 (≠ Y86), N84 (≠ Y90), A108 (≠ G114), S111 (≠ G117), A130 (≠ P136), F131 (≠ E137), L136 (≠ F142), P138 (= P144), D139 (= D145)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K59), A62 (= A63), Q64 (≠ G65), D65 (= D66), L66 (≠ I67), Y76 (≠ L79), A108 (≠ G114), F131 (≠ E137), D139 (= D145)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
31% identity, 57% coverage: 4:200/344 of query aligns to 6:199/261 of 5jbxB
- active site: A67 (≠ G65), R72 (≠ E72), L84 (≠ Y86), R88 (≠ Y90), G112 (= G114), E115 (≠ G117), T134 (≠ P136), E135 (= E137), I140 (≠ F142), P142 (= P144), G143 (≠ D145)
- binding coenzyme a: S24 (≠ K22), R25 (≠ A23), R26 (≠ L24), A28 (= A26), A65 (= A63), D68 (= D66), L69 (≠ I67), K70 (= K68), L110 (≠ M112), G111 (= G113), T134 (≠ P136), E135 (= E137), L138 (≠ I140), R168 (= R169)
Sites not aligning to the query:
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
30% identity, 55% coverage: 16:205/344 of query aligns to 13:186/245 of 6slaAAA
- active site: Q61 (≠ G65), L68 (≠ Y86), N72 (≠ Y90), A96 (≠ G114), S99 (≠ G117), A118 (≠ P136), F119 (≠ E137), L124 (≠ F142), P126 (= P144), N127 (≠ D145)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (= L24), A59 (= A63), Q61 (≠ G65), D62 (= D66), L63 (≠ I67), L68 (≠ Y86), Y71 (≠ E89), A94 (≠ M112), G95 (= G113), A96 (≠ G114), F119 (≠ E137), I122 (= I140), L124 (≠ F142), N127 (≠ D145)
Sites not aligning to the query:
6eqoA Tri-functional propionyl-coa synthase of erythrobacter sp. Nap1 with bound NADP+ and phosphomethylphosphonic acid adenylate ester (see paper)
34% identity, 44% coverage: 16:168/344 of query aligns to 870:1019/1804 of 6eqoA
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 456, 458, 535, 536, 537, 538, 558, 559, 560, 561, 562, 688, 714
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 1261, 1265, 1379, 1400, 1403, 1404, 1405, 1424, 1425, 1429, 1444, 1492, 1493, 1497, 1514, 1517, 1713, 1730, 1731, 1774
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
28% identity, 53% coverage: 5:186/344 of query aligns to 41:223/763 of P40939
Sites not aligning to the query:
- 282 V → D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- 305 I → N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- 342 L → P: in LCHAD deficiency; dbSNP:rs137852772
- 510 active site, For hydroxyacyl-coenzyme A dehydrogenase activity; E → Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
32% identity, 56% coverage: 7:200/344 of query aligns to 12:202/266 of O53561
- K135 (≠ L132) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 132:139, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ G139) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
Query Sequence
>WP_043745113.1 NCBI__GCF_000009985.1:WP_043745113.1
MSAEIHFDRTGHLGRITLDRPKALNALTLDQVHAMHPRLDQWAADADVACITIEGAGEKA
FCAGGDIKQLYEACKAGDLEFAAAFYRDEYRLNRRIHTSPKPYVALIDGIVMGGGVGVSV
HGLYRVATERTLFAMPETGIGFFPDVGGSYFLPRLPGSIGMYLGLTGARLKAADTLHVGV
ATHFVESAQLPALIEALSEARDAAEVKASLDGFASDPGPAAIDARRELIDRCFGKASLAE
VFAALEGESDPFAAETLATIRAKSPHLVAVSFEMIRRGATLSFDDCMKMEFRLAMALAPA
HDFVEGVRALLIDRDNKPAWNPAGTEGQVLAHFDAVPGCGDLTF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory