SitesBLAST
Comparing WP_043745402.1 NCBI__GCF_000009985.1:WP_043745402.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 65% coverage: 1:411/635 of query aligns to 1:398/554 of P22106
- M1 (= M1) modified: Initiator methionine, Removed
- C2 (= C2) mutation C->A,S: Loss of glutamine-dependent activity but no effect on ammonia-dependent asparagine synthetase activity.
- H30 (= H30) mutation to A: 4,5-fold decrease in glutamine affinity.
- D34 (= D34) mutation D->N,E: Little effect on the kinetic properties.
- H81 (= H84) mutation to A: 5-fold decrease in glutamine affinity.
- A105 (≠ E108) mutation to H: Little effect on the kinetic properties.
- E349 (≠ D371) mutation E->A,Q: Loss of glutamine- and ammonia-dependent synthetase activity, but still exhibits glutaminase activity.; mutation to D: 5-fold increase in affinity for aspartate when assaying both the glutamine- and ammonia-dependent synthetase reactions, and 2-fold decrease in kcat for these reactions. Modifies the product glutamate/asparagine stoichiometry.
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
32% identity, 60% coverage: 30:411/635 of query aligns to 29:381/497 of 1ct9A
- active site: L50 (= L53), N74 (= N78), G75 (= G79), T305 (vs. gap), R308 (vs. gap), E332 (≠ D371), M366 (vs. gap)
- binding adenosine monophosphate: L232 (≠ F269), L233 (= L270), S234 (= S271), S239 (= S276), A255 (≠ T295), V256 (≠ I296), D263 (≠ E305), M316 (≠ L356), S330 (= S369), G331 (= G370), E332 (≠ D371)
- binding glutamine: R49 (= R52), L50 (= L53), I52 (= I55), V53 (≠ I56), N74 (= N78), G75 (= G79), E76 (= E80), D98 (= D102)
Sites not aligning to the query:
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 65% coverage: 1:411/635 of query aligns to 1:405/557 of P78753
- S391 (≠ P397) modified: Phosphoserine
Sites not aligning to the query:
- 489 modified: Phosphoserine
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
30% identity, 57% coverage: 25:387/635 of query aligns to 20:368/509 of 6gq3A
- active site: L49 (= L53), N74 (= N78), G75 (= G79), T324 (≠ P344), R327 (≠ A348)
- binding 5-oxo-l-norleucine: R48 (= R52), V51 (≠ I55), V52 (≠ I56), Y73 (≠ F77), N74 (= N78), G75 (= G79), E76 (= E80), V95 (≠ S101), D96 (= D102)
Sites not aligning to the query:
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
29% identity, 61% coverage: 1:387/635 of query aligns to 1:381/561 of P08243
- C2 (= C2) active site, For GATase activity; mutation to A: Loss of the glutamine-dependent asparagine synthetase activity, while the ammonia-dependent activity remained unaffected.
- A6 (≠ G6) to E: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122975
- V210 (≠ C229) to E: in dbSNP:rs1049674
- F362 (≠ L368) to V: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122973
Sites not aligning to the query:
- 550 R → C: in ASNSD; increases level of protein abundance; dbSNP:rs398122974
1jgtB Crystal structure of beta-lactam synthetase (see paper)
33% identity, 40% coverage: 79:334/635 of query aligns to 74:306/500 of 1jgtB
Sites not aligning to the query:
- active site: 73, 319, 345, 379, 440
- binding diphosphomethylphosphonic acid adenosyl ester: 327, 344, 345, 348, 420, 440
- binding n2-(carboxyethyl)-l-arginine: 323, 345, 346, 348, 349, 354, 370, 379
- binding magnesium ion: 348
1mb9A Beta-lactam synthetase complexed with atp (see paper)
33% identity, 40% coverage: 79:334/635 of query aligns to 71:297/485 of 1mb9A
- active site: G71 (= G79)
- binding adenosine monophosphate: V235 (≠ F269), L236 (= L270), S242 (= S276), S260 (≠ T295), M261 (≠ I296)
- binding adenosine-5'-triphosphate: V235 (≠ F269), L236 (= L270), S237 (= S271), G239 (= G273), D241 (= D275), S242 (= S276), S260 (≠ T295), M261 (≠ I296)
- binding magnesium ion: D241 (= D275)
- binding pyrophosphate 2-: S237 (= S271), G239 (= G273), D241 (= D275), S242 (= S276)
Sites not aligning to the query:
- active site: 70, 310, 336, 370, 431
- binding adenosine monophosphate: 314, 318, 335, 336
- binding adenosine-5'-triphosphate: 318, 335, 339, 411, 431
- binding magnesium ion: 339
- binding pyrophosphate 2-: 339, 411, 431
1mbzA Beta-lactam synthetase with trapped intermediate (see paper)
33% identity, 40% coverage: 79:334/635 of query aligns to 70:298/496 of 1mbzA
Sites not aligning to the query:
- active site: 69, 311, 337, 371, 432
- binding arginine-n-methylcarbonyl phosphoric acid 5'-adenosine ester: 315, 319, 336, 337, 338, 340, 341, 362, 371, 432, 434, 435
- binding magnesium ion: 340
- binding pyrophosphate 2-: 340, 412, 432, 433
1mc1A Beta-lactam synthetase with product (dgpc), amp and ppi (see paper)
33% identity, 40% coverage: 79:334/635 of query aligns to 66:293/491 of 1mc1A
Sites not aligning to the query:
- active site: 65, 306, 332, 366, 427
- binding adenosine monophosphate: 331, 427, 430
- binding magnesium ion: 335
- binding deoxyguanidinoproclavaminic acid: 310, 332, 333, 336, 357, 366, 427
- binding pyrophosphate 2-: 335, 407, 427, 428
Q9XB61 Carbapenam-3-carboxylate synthase; Carbapenam-3-carboxylate ligase; EC 6.3.3.6 from Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) (see 3 papers)
33% identity, 18% coverage: 266:379/635 of query aligns to 241:353/503 of Q9XB61
- 244:251 (vs. 269:276, 75% identical) binding
- I270 (= I296) binding
- GYGSD 344:348 (≠ GDGAD 370:374) binding
- Y345 (≠ D371) mutation to A: Loss of activity.; mutation to F: Reduces catalytic efficiency.
- G346 (= G372) binding
Sites not aligning to the query:
- 371 binding
- 374 binding
- 380 E→A: Loss of activity.; E→D: Reduces catalytic efficiency.; E→Q: Reduces catalytic efficiency.
- 421 binding
- 443 mutation K->A,M: Loss of activity.
- 444:446 binding
1q19A Carbapenam synthetase (see paper)
33% identity, 18% coverage: 266:379/635 of query aligns to 240:352/500 of 1q19A
- active site: L318 (≠ A348), E321 (≠ L351), Y344 (≠ D371)
- binding diphosphomethylphosphonic acid adenosyl ester: P243 (≠ F269), L244 (= L270), S245 (= S271), D249 (= D275), S250 (= S276), S268 (≠ T295), I269 (= I296), T342 (≠ S369), G343 (= G370), D347 (= D374)
- binding (2s,5s)-5-carboxymethylproline: Y344 (≠ D371), G345 (= G372), L348 (≠ E375)
Sites not aligning to the query:
Query Sequence
>WP_043745402.1 NCBI__GCF_000009985.1:WP_043745402.1
MCGFAGFLDLTRATPDRETVVRAMAATLVHRGPDDDGAWVDDDAGVALGFRRLAIIDLTP
QGHQPMTSHDGRWVISFNGEIYNHADLRARLGESMAWRGHSDTEVLLEAVSAWGIEAALA
AFDGMFAFALWDRRERVLTLARDRFGEKPLYWAKAGGSLLFGSELKALRAHPAWTGGIDR
DALALYMRLGWIPAPHTIHPGVFKLEPGHLMRVNGGDISAKAYWSAADCAAGLEDSFAGS
AEDAADRLEELLRESVRLRMQADVPVGVFLSGGIDSSATAALMRQLSAEPVHSFTIGFDQ
AGLDESAHARAVADHLGTLHTEVRISDAEALAQVARLPVLYDEPFADAAALPTALLAQVT
RKSVTVALSGDGADELFGGYGIYRSIPRDWRRLQGLPDGLRALGAMGARGLAGPAEGLAA
LAGTVRKRRSHPGHRLGREAERLEAGSLAELLGLHYSRWRGMSDLVPGAGRAESLFSAPT
PRLHDDALATMVLDAMGYLPDDLCVKTDRATMGASLEARLPFLALDIARFAWSLPTSLKI
EGETGKAVLRRVLYRLVPRALVDRPKMGFEVPLRRWLNGPLRDWADDLLSEERLRRQGHL
NAALVAQCWREHRSGAKNWQNEMWHALMFQAWLEH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory