SitesBLAST – Find functional sites

 

SitesBLAST

Other sequence analysis tools:

Find papers: PaperBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Comparing YmcF to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree

Found no hits to proteins with known functional sites (download)

Query Sequence

>YmcF
MTQHLHFRCPCCHGSQYRTSAFDVTERNPLGAKCIFCKSTMITFDNVALQIRTDHAPLDF
TK

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory