Comparing mRNA_6818 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8uscA 26S proteasome regulatory subunit 7
77% identity, 99% coverage: 1:71/72 of query aligns to 344:414/415 of 8uscA
Sites not aligning to the query:
5vfpA 26S proteasome regulatory subunit 6A (see paper)
77% identity, 99% coverage: 1:71/72 of query aligns to 309:379/380 of 5vfpA
Sites not aligning to the query:
5gjqH Structure of the human 26s proteasome bound to usp14-ubal (see paper)
77% identity, 99% coverage: 1:71/72 of query aligns to 309:379/380 of 5gjqH
Sites not aligning to the query:
9e8iA 26S proteasome regulatory subunit 7 (see paper)
77% identity, 99% coverage: 1:71/72 of query aligns to 324:394/395 of 9e8iA
Sites not aligning to the query:
6fvuH 26S proteasome regulatory subunit 7 homolog (see paper)
76% identity, 100% coverage: 1:72/72 of query aligns to 355:426/426 of 6fvuH
Sites not aligning to the query:
6fvtH 26S proteasome regulatory subunit 8 homolog (see paper)
76% identity, 100% coverage: 1:72/72 of query aligns to 355:426/426 of 6fvtH
Sites not aligning to the query:
7qo4H 26s proteasome wt-ubp6-ubvs complex in the si state (atpases, rpn1, ubp6, and ubvs)
76% identity, 100% coverage: 1:72/72 of query aligns to 320:391/391 of 7qo4H
Sites not aligning to the query:
O42931 26S proteasome regulatory subunit 7 homolog from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
73% identity, 97% coverage: 1:70/72 of query aligns to 366:435/438 of O42931
Sites not aligning to the query:
Q9SSB5 26S proteasome regulatory subunit 7 homolog A; 26S proteasome AAA-ATPase subunit RPT1a; 26S proteasome subunit 7 homolog A; Regulatory particle triple-A ATPase subunit 1a from Arabidopsis thaliana (Mouse-ear cress) (see paper)
72% identity, 99% coverage: 1:71/72 of query aligns to 355:425/426 of Q9SSB5
8amzH Spinach 19s proteasome
72% identity, 99% coverage: 1:71/72 of query aligns to 323:393/394 of 8amzH
Sites not aligning to the query:
5mpbH proteasome in presence of AMP-PNP (s3) (see paper)
79% identity, 86% coverage: 1:62/72 of query aligns to 319:380/380 of 5mpbH
Sites not aligning to the query:
6ef0H Yeast 26s proteasome bound to ubiquitinated substrate (1d Motor state) (see paper)
79% identity, 86% coverage: 1:62/72 of query aligns to 196:257/257 of 6ef0H
Sites not aligning to the query:
5m32h Human 26s proteasome in complex with oprozomib (see paper)
49% identity, 79% coverage: 1:57/72 of query aligns to 276:332/332 of 5m32h
Sites not aligning to the query:
P62196 26S proteasome regulatory subunit 8; 26S proteasome AAA-ATPase subunit RPT6; Proteasome 26S subunit ATPase 5; Proteasome subunit p45; p45/SUG; mSUG1 from Mus musculus (Mouse) (see 2 papers)
49% identity, 79% coverage: 1:57/72 of query aligns to 336:392/406 of P62196
Sites not aligning to the query:
P62195 26S proteasome regulatory subunit 8; 26S proteasome AAA-ATPase subunit RPT6; Proteasome 26S subunit ATPase 5; Proteasome subunit p45; Thyroid hormone receptor-interacting protein 1; TRIP1; p45/SUG from Homo sapiens (Human) (see 2 papers)
49% identity, 79% coverage: 1:57/72 of query aligns to 336:392/406 of P62195
Sites not aligning to the query:
6msgC 26S proteasome regulatory subunit 6A (see paper)
49% identity, 79% coverage: 1:57/72 of query aligns to 326:382/396 of 6msgC
Sites not aligning to the query:
9e8jC Nub1/fat10-processing human 26s proteasome bound to txnl1 with rpt1 at top of spiral staircase (see paper)
49% identity, 79% coverage: 1:57/72 of query aligns to 316:372/386 of 9e8jC
Sites not aligning to the query:
5gjqJ Structure of the human 26s proteasome bound to usp14-ubal (see paper)
49% identity, 79% coverage: 1:57/72 of query aligns to 297:353/358 of 5gjqJ
Sites not aligning to the query:
5vfqC 26S proteasome regulatory subunit 8 (see paper)
49% identity, 79% coverage: 1:57/72 of query aligns to 297:353/363 of 5vfqC
Sites not aligning to the query:
Q9XTT9 26S proteasome regulatory subunit 8; 26S proteasome AAA-ATPase subunit rpt-6; Proteasome regulatory particle ATPase-like protein 6 from Caenorhabditis elegans (see paper)
51% identity, 79% coverage: 1:57/72 of query aligns to 346:402/416 of Q9XTT9
Sites not aligning to the query:
>mRNA_6818
MAVERNIRFDLIARLCPNSTGAELRSVCTEAGMFAIRQRRKIATEKDFLDAVEKVIRSGQ
KFSSTSLYANYQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory