Align Carbamoyl-phosphate synthase arginine-specific small chain; EC 6.3.5.5; Carbamoyl-phosphate synthetase glutamine chain (uncharacterized)
to candidate Pf1N1B4_2547 Anthranilate synthase, amidotransferase component (EC 4.1.3.27) @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)
Query= curated2:P36838 (353 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2547 Length = 197 Score = 68.9 bits (167), Expect = 1e-16 Identities = 48/163 (29%), Positives = 76/163 (46%), Gaps = 11/163 (6%) Query: 174 SIASSLVKRGCKVTVVPYQQMEA--VYNIKPDGIVLSNGPGDPKAIQPYLGKIKSIISRF 231 ++ L + G +V VV ++ + + P+ IV+S GP P + IK + Sbjct: 14 NVVQYLGELGSEVKVVRNDELTIAEIEALNPERIVVSPGPCTPTEAGISIEAIKHFAGKL 73 Query: 232 PTLGICLGHQLIALAFGGNTFKLPFGHRGANHPV------IDRKTKRVFMTSQNHSYVVD 285 P LG+CLGHQ I AFGG+ + G PV + R ++ HS +V Sbjct: 74 PILGVCLGHQSIGQAFGGDVVRARQVMHGKTSPVFHEDKGVFEGLNRPLTVTRYHSLIVK 133 Query: 286 EQSINEEELTIRFHHVNDTSVE---GLAHKKLPVMSVQFHPEA 325 +++ + + + D SV+ GL HK L + VQFHPE+ Sbjct: 134 RETLPDCLELTAWTQLEDGSVDEIMGLRHKTLNIEGVQFHPES 176 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 197 Length adjustment: 25 Effective length of query: 328 Effective length of database: 172 Effective search space: 56416 Effective search space used: 56416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory