Align Acetylornithine aminotransferase; Short=ACOAT; EC 2.6.1.11 (characterized, see rationale)
to candidate Pf1N1B4_2980 Acetylornithine aminotransferase (EC 2.6.1.11)
Query= uniprot:A0A806JQF3 (400 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2980 Length = 391 Score = 316 bits (809), Expect = 8e-91 Identities = 181/394 (45%), Positives = 237/394 (60%), Gaps = 18/394 (4%) Query: 17 AVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGHRHPAVIEAVTRQMSTL 76 A +M+ Y ++ + G G + D GR Y+D + G+AV +GH HP ++ A++ Q L Sbjct: 4 ACLMSTYQPLALSFSKGLGTRLWDQAGREYLDAVAGVAVTNVGHSHPRIVAAISEQAGLL 63 Query: 77 GHTSNLYATEPGIALAEELVALLGADQRTRVFFCNSGAEANEAAFKLSRLTGRTK----- 131 HTSNLY+ + LA +LV L G D R FF NSGAEANE A KL+RL G K Sbjct: 64 LHTSNLYSIDWQQRLARKLVRLSGMD---RAFFNNSGAEANETALKLARLYGWHKGIEQP 120 Query: 132 -LVAAHDAFHGRTMGSLALTGQPAKQTPFAPLPGDVTHVGYGDVDALAAAVDDH---TAA 187 +V +AFHGRT+G+L+ + PA + F LPGD V +GD+ AL A H A Sbjct: 121 LVVVMENAFHGRTLGTLSASDGPAVRLGFNELPGDFIKVPFGDLAALEAVQQAHGPRIVA 180 Query: 188 VFLEPIMGESGVVVPPAGYLAAARDITARRGALLVLDEVQTGMGRTGAFFAHQHDGITPD 247 + +EP+ GESGV V P GYL A R++ RR LL+LDE+QTG+GRTG +FA QH+GI PD Sbjct: 181 ILMEPVQGESGVQVAPPGYLKAVRELCNRRAWLLMLDEIQTGIGRTGQWFAFQHEGIVPD 240 Query: 248 VVTLAKGLGGGLPIGACLAVGPAAELLTPGLHGSTFGGNPVCAAAALAVLRVLASDGLVR 307 V+TLAKGLG G+PIGACLA G AA+L TPG HGSTFGGNP+ VL ++ GL+ Sbjct: 241 VMTLAKGLGNGIPIGACLARGKAADLFTPGSHGSTFGGNPLACRVGCTVLEIIEEQGLLE 300 Query: 308 RAEVLGKSL--RHGIEALGHPLIDHVRGRGLLLGIALTAPHAKDAEATARDAGYLVNAAA 365 A + G+ L R IE P + +RG+GL++GI L P ARD G L+N Sbjct: 301 NARLQGERLLARLRIELADDPNVLAIRGQGLMIGIELKQPIRDLTLIAARDHGLLINVTR 360 Query: 366 PDVIRLAPPLIIAEAQLDGFVAALPAILDRAVGA 399 IRL PPL I E +++ V + RAV A Sbjct: 361 GKTIRLLPPLTIDEREVEMIVRG----VGRAVSA 390 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 391 Length adjustment: 31 Effective length of query: 369 Effective length of database: 360 Effective search space: 132840 Effective search space used: 132840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory