Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_011317715.1 AVA_RS04365 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_000204075.1:WP_011317715.1 Length = 290 Score = 260 bits (664), Expect = 4e-74 Identities = 126/262 (48%), Positives = 184/262 (70%), Gaps = 1/262 (0%) Query: 93 ALLVSRKKKPEDTIVDIKGEKIGDGQQRFIVG-PCAVESYEQVAEVAAAAKKQGIKILRG 151 A LVS+ TIV I G++ I+G PC VES +Q+ VA + ++ LRG Sbjct: 4 AKLVSQSHPNHQTIVQISETVAFGGKELVIIGGPCTVESLQQMETVAQRLEGSSVQALRG 63 Query: 152 GAFKPRTSPYDFQGLGVEGLQILKRVADEFDLAVISEIVTPAHIEEALDYIDVIQIGARN 211 G +KPRTSPY FQG+G GL +L +V +++ V++E+++ A IE ++D++Q+G+RN Sbjct: 64 GVYKPRTSPYAFQGMGEAGLDVLAQVRSHYNMPVVTEVMSIAQIEAIATHVDMLQVGSRN 123 Query: 212 MQNFELLKAAGAVKKPVLLKRGLAATISEFINAAEYIMSQGNDQIILCERGIRTYETATR 271 MQNF+LLKA G KP+LLKRGLAATI EF+ AAEY++S GN ++LCERGIR+++ TR Sbjct: 124 MQNFDLLKALGQAGKPILLKRGLAATIEEFVMAAEYVVSHGNPDVVLCERGIRSFDNYTR 183 Query: 272 NTLDISAVPILKQETHLPVFVDVTHSTGRRDLLLPTAKAALAIGADGVMAEVHPDPSVAL 331 N LD++AV LKQ THLPV VD +H+ G+R+L+ P AKAA+A GADG++ E HP+P ++ Sbjct: 184 NVLDLAAVVALKQITHLPVIVDPSHAVGKRELVAPLAKAAVACGADGLIIECHPEPEKSV 243 Query: 332 SDSAQQMAIPEFEKWLNELKPM 353 SD+ Q +++ + ++ LKP+ Sbjct: 244 SDARQALSLEDMVSLVDSLKPV 265 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 290 Length adjustment: 28 Effective length of query: 330 Effective length of database: 262 Effective search space: 86460 Effective search space used: 86460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory