Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_011318722.1 AVA_RS09720 indole-3-glycerol phosphate synthase TrpC
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_000204075.1:WP_011318722.1 Length = 296 Score = 188 bits (477), Expect = 2e-52 Identities = 116/260 (44%), Positives = 156/260 (60%), Gaps = 12/260 (4%) Query: 3 QTVLAKIVADKAIWVEARKQQQPLASFQNE--VQPSTRHFYDALQGART--AFILECKKA 58 Q +L +IV K + V+ +++ PL Q + + P TR F+ AL+ RT A I E KKA Sbjct: 29 QHILEEIVWQKEVEVDQMREKLPLLELQKKARIAPPTRDFFAALKQGRTTPALIAEVKKA 88 Query: 59 SPSKGVIRDDFDPARIAAIYKHY-ASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCKDF 117 SPSKGV R+DFDP IA Y+ AS ISVLTDEK+FQGSF+ L V P+LCKDF Sbjct: 89 SPSKGVFREDFDPVAIALSYQQGGASCISVLTDEKFFQGSFDNLTKVRAAVDLPLLCKDF 148 Query: 118 IIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIAL 177 +I PYQ+YLAR ADA LL+ ++L D + +A +L M L EV N EE +R +AL Sbjct: 149 VIYPYQMYLARIQGADAVLLIAAILSDQDLQYFIKIAKALNMAALVEVHNLEELDRVLAL 208 Query: 178 -GAKVVGINNRDLRDLSIDLNRTRELAPKLG-----HNVTVISESGINTYAQVRELSHF- 230 G +VGINNR+L D S+DL T +L G N+ V+SESG++ + +S Sbjct: 209 DGVSLVGINNRNLEDFSVDLQTTCQLLAARGSQLQERNILVVSESGLHNPEDLSLVSQSG 268 Query: 231 ANGFLIGSALMAHDDLHAAV 250 A+ LIG +L+ D A+ Sbjct: 269 ASAVLIGESLVKQPDPELAI 288 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 296 Length adjustment: 30 Effective length of query: 423 Effective length of database: 266 Effective search space: 112518 Effective search space used: 112518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory