Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate AZOBR_RS23905 AZOBR_RS23905 hypothetical protein
Query= curated2:Q2IH94 (492 letters) >FitnessBrowser__azobra:AZOBR_RS23905 Length = 466 Score = 286 bits (731), Expect = 1e-81 Identities = 182/466 (39%), Positives = 244/466 (52%), Gaps = 26/466 (5%) Query: 16 AGAGVAAKAISSTELVEASLARIQATDGKLGAFLAVCADRARAAAKAADARAARGERRSE 75 +G G + +S A LARI++ + + A LAV AD A A+A D A G+ Sbjct: 12 SGGGSPSMPGASEAETRARLARIESLNPIVNALLAVDADGAIRRARAQDEARAAGDWPGL 71 Query: 76 LDGVPVAVKDLFVTKGVPTTAGSRILEGYLPPYDATVVERLEAAGAVIVGKLNMDEFAMG 135 LDGV V VKD F G T+ GS + DA ++ RL AGA++VG+ N+ EF +G Sbjct: 72 LDGVTVTVKDCFELAGETTSYGSSDRFARMGHRDAPLIRRLRDAGAILVGRNNLSEFCLG 131 Query: 136 SSNENSAYKPCHNPWDLSRTPGGSSGGSAASVAAGQVHASLGTDTGGSIREPAAFCGVVG 195 S+N+N + PC NPWD R PGGSSGGSAASVAAG S+GTDTGGSIR PAA CGVVG Sbjct: 132 STNQNEHHGPCRNPWDTGRVPGGSSGGSAASVAAGLCRVSIGTDTGGSIRIPAALCGVVG 191 Query: 196 VKPTYGRVSRYGVVAFASSLDQVGPLAREVGDAALVLRTIAGHDPRDMTSSTRPVDDYLG 255 ++P+ GRVS GV+ + D VGPLA V D A IAG+DP D S P+ ++L Sbjct: 192 LRPSVGRVSNSGVIPCSVDFDTVGPLAYSVADVARAFAAIAGYDPEDPNSVDVPLGNFLP 251 Query: 256 PLEEGARGLRVGVPREWLSGGLDAGVEAAIRAALDTYRRLGATLVDVSLPHSKYGIGAYY 315 L+ G G R+G+PR + L V +RAA + GA LVDV++ ++ Sbjct: 252 DLKAGIAGTRIGLPRNFYFDNLQPAVAERVRAAAAVLEKAGAVLVDVTIEDAE------- 304 Query: 316 LIAPAEASSNLARYDGVRYGLRAEGAKGLKEMYAESREQGLGAEPKRRIMLGTYALSSGY 375 +A A + +L D +Y L E+ + +G E RR+ LG Y Sbjct: 305 -VAQARTAFSLLVADMAQYHLDK----------METAPESIGPEVLRRLQLGLPVSGVQY 353 Query: 376 YDA-YYLRAQKVRTLIRRDFDEAFRGCDVIAGPVTPSVAFALGERTGDPLQMYLADIFTI 434 D+ +L + K+R F F D+I P T A + + FT Sbjct: 354 ADSRRWLASWKLR------FRALFERVDLILTPTTSITAPRIYDSADMIEATRAVSRFTY 407 Query: 435 TCNLAALPGLSVPCGLEAASGLPVGLQLVGRPFDEATLFRAARALE 480 LP +SVPCG + G+PVGLQ+VGR FDE +FRA A + Sbjct: 408 GFGALGLPAMSVPCGFD-GDGMPVGLQIVGRWFDEPLVFRAGAAFQ 452 Lambda K H 0.317 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 594 Number of extensions: 35 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 466 Length adjustment: 34 Effective length of query: 458 Effective length of database: 432 Effective search space: 197856 Effective search space used: 197856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory