PaperBLAST

PaperBLAST Hits for SwissProt::Q924V4 Solute carrier family 15 member 3; Peptide transporter 3; Peptide/histidine transporter 2 (Rattus norvegicus (Rat)) (582 a.a., MSALRAEQQP...)

Show query sequence

>SwissProt::Q924V4 Solute carrier family 15 member 3; Peptide transporter 3; Peptide/histidine transporter 2 (Rattus norvegicus (Rat))
MSALRAEQQPSRSGERQPLVAQGRWGPRRWRRTAAAAVLLVEMLERAAFFGVTSNLVLYL
NSLNFNWDGEHASRATLLFLGASYLLAPVGGWLADVYLGRFLAISLSLLLYLAATGLLLT
TITDDGRRSFCGEMPELPLKPACPSANCQGSWSSPYCATTLYLVLLLLALAASSVRSNLT
SFGADQVMDLGRDATRRFFNWFYWSINLGAILSLLVVAFIEQNISFLQGYSIIVGLVGLA
FFIFLIATPVFITKPPTGSQVSSMLNLAFQNCCPGWQWWRRPSSRNSEGAHLLPDQRSNQ
PGPSPQEDMANFQVLLKVLPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFRTNPNISL
PLRSDSSNYRIPEAWLLLANVAVILILVPVKDHLIDPLLLRCKLLPSALQKMALGMFFGF
TSIIVAGVLEKERLQYIAANQTVPQLIGKDLYYAAPLSIWWQIPQYLLIGISEIFASIPG
LEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSGLVALLSLPGGWMYCPKDFGNINNCRMD
LYFFLLAGIQAVTAVLFLWIAGRYERTRQDPDSQNSTSRVRG

Running BLASTp...

Found 276 similar proteins in the literature:

S15A3_RAT / Q924V4 Solute carrier family 15 member 3; Peptide transporter 3; Peptide/histidine transporter 2 from Rattus norvegicus (Rat) (see paper)
100% identity, 100% coverage

• function: Proton-coupled amino-acid transporter that transports free histidine and certain di- and tripeptides, and is involved in innate immune response (PubMed:11336635). Also able to transport carnosine (By similarity). Involved in the detection of microbial pathogens by toll- like receptors (TLRs) and NOD-like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand (By similarity).
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + n H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + n H(+)(in) (RHEA:76371)
  catalytic activity: glycylglycylglycine(out) + n H(+)(out) = glycylglycylglycine(in) + n H(+)(in) (RHEA:76391)
  catalytic activity: carnosine(out) + n H(+)(out) = carnosine(in) + n H(+)(in) (RHEA:76383)
  catalytic activity: L-histidine(out) + n H(+)(out) = L-histidine(in) + n H(+)(in) (RHEA:76379)

S15A3_MOUSE / Q8BPX9 Solute carrier family 15 member 3; Peptide transporter 3; Peptide/histidine transporter 2; cAMP-inducible gene 1 protein from Mus musculus (Mouse) (see 2 papers)
NP_075531 solute carrier family 15 member 3 from Mus musculus
93% identity, 100% coverage

• function: Proton-coupled amino-acid transporter that transports free histidine and certain di- and tripeptides, and is involved in innate immune response (PubMed:24695226). Also able to transport carnosine (By similarity). Involved in the detection of microbial pathogens by toll- like receptors (TLRs) and NOD-like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand (PubMed:24695226).
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + n H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + n H(+)(in) (RHEA:76371)
  catalytic activity: glycylglycylglycine(out) + n H(+)(out) = glycylglycylglycine(in) + n H(+)(in) (RHEA:76391)
  catalytic activity: carnosine(out) + n H(+)(out) = carnosine(in) + n H(+)(in) (RHEA:76383)
  catalytic activity: L-histidine(out) + n H(+)(out) = L-histidine(in) + n H(+)(in) (RHEA:76379)
• SLC15A3 plays a crucial role in pulmonary fibrosis by regulating macrophage oxidative stress.
  Luo, Cell death and differentiation 2024
  • GeneRIF: SLC15A3 plays a crucial role in pulmonary fibrosis by regulating macrophage oxidative stress.
• Proteomics Investigation of the Time Course Responses of RAW264.7 Macrophages to Infections With the Wild-Type and Twin-Arginine Translocation Mutant Strains of Brucella melitensis
  Yan, Frontiers in cellular and infection microbiology 2021
  • “...ACOD1 1.78**/2.00** 2.53*/2.33** Q05769 PTGS2 3.88**/3.47** 5.65**/6.79** Q64337 SQSTM1 2.32**/1.90** 3.05**/2.42** Q64345 IFIT3 2.12**/3.29* 3.74**/11.09* Q8BPX9 SLC15A3 1.59/1.25 2.11**/2.28* 3.11**/4.41** Q60766 IRGM1 1.62**/1.54** P10923 SPP1 1.91*/1.66** 3.31**/3.96** Q9QY24 ZBP1 2.85/6.08** O08573 LGALS9 2.10**/2.97** -, not significantly regulated, *p 0.05, **p 0.01. Tat-Mutant Infection Induces Higher Proinflammatory...”

S15A3_HUMAN / Q8IY34 Solute carrier family 15 member 3; Osteoclast transporter; Peptide transporter 3; Peptide/histidine transporter 2; hPHT2 from Homo sapiens (Human) (see 4 papers)
TC 2.A.17.3.9 / Q8IY34 solute carrier family 15, member 3, di- and tri-peptide uptake transporter in immune cells from Homo sapiens (see 3 papers)
NP_057666 solute carrier family 15 member 3 from Homo sapiens
81% identity, 100% coverage

• function: Proton-coupled amino-acid transporter that transports free histidine and certain di- and tripeptides, and is involved in innate immune response (By similarity). Also able to transport carnosine (PubMed:31073693, PubMed:31254495). Involved in the detection of microbial pathogens by toll-like receptors (TLRs) and NOD-like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand (By similarity).
  catalytic activity: glycylglycylglycine(out) + n H(+)(out) = glycylglycylglycine(in) + n H(+)(in) (RHEA:76391)
  catalytic activity: carnosine(out) + n H(+)(out) = carnosine(in) + n H(+)(in) (RHEA:76383)
  catalytic activity: L-histidine(out) + n H(+)(out) = L-histidine(in) + n H(+)(in) (RHEA:76379)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + n H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + n H(+)(in) (RHEA:76371)
• substrates: dipeptides, tripeptides
• Molecular basis of TASL recruitment by the peptide/histidine transporter 1, PHT1.
  Custódio, Nature communications 2023
  • “...chicken PHT1 (Uniprot accession number F1NG54), full-length human PHT1(accession number Q8N697), full-length PHT2 (accession number Q8IY34), full-length chicken TASL (Uniprot accession number A0A1L1RS25) and full-length human TASL (Uniprot accession number Q9HAI6) were inserted into an expression construct based on the pXLG vector 58 . For chicken...”
  • “...codes: chicken PHT1 (Uniprot accession number F1NG54), human PHT1 (accession number Q8N697), PHT2 (accession number Q8IY34), chicken TASL (Uniprot accession number A0A1L1RS25), human TASL (Uniprot accession number Q9HAI6), human SLC15A5 (accession number A6NIM6), human Pept1 (accession number P46059) and human PepT2 (accession number Q16348). Source data...”
• THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
  Alexander, British journal of pharmacology 2017
  • “...nomenclature SLC15A1 SLC15A2 SLC15A3 SLC15A4 HGNC, UniProt SLC15A1 , P46059 SLC15A2 , Q16348 SLC15A3 , Q8IY34 SLC15A4 , Q8N697 Common abreviation PepT1 PepT2 PHT2 PHT1 Substrates fMetLeuPhe [ 375 , 576 ], HisLeulopinavir [ 367 ], DAlaLysAMCA [ 319 , 508 ], AlaLysAMCA [ 3 ,...”
• The Concise Guide to PHARMACOLOGY 2015/16: Transporters
  Alexander, British journal of pharmacology 2015
  • “...abreviation PepT1 PepT2 PHT2 PHT1 HGNC, UniProt SLC15A1 , P46059 SLC15A2 , Q16348 SLC15A3 , Q8IY34 SLC15A4 , Q8N697 Substrates fMetLeuPhe [ 337 ], cefadroxil [ 177 ], valacyclovir [ 178 ], cyclacillin [ 177 ], muramyl dipeptide [ 496 ] cefadroxil [ 177 ], cyclacillin...”
• The Concise Guide to PHARMACOLOGY 2013/14: transporters
  Alexander, British journal of pharmacology 2013
  • “...SLC15A3 SLC15A4 Common abbreviation PepT1 PepT2 PHT2 PHT1 HGNC, UniProt SLC15A1, P46059 SLC15A2, Q16348 SLC15A3, Q8IY34 SLC15A4, Q8N697 Endogenous substrates 5-aminolevulinic acid 253 , dipeptides 253 , tripeptides 253 5-aminolevulinic acid, dipeptides, tripeptides L-histidine, carnosine, dipeptides, tripeptides L-histidine, carnosine, dipeptides, tripeptides Substrates fMet-Leu-Phe 260 , cyclacillin...”
• Massive peptide sharing between viral and human proteomes
  Kanduc, Peptides 2008
  • “...Q9NSQ0; Q5T5R8; Q2VU70; Q13901; Q9BWL2; Q5T4D3; Q5QPV6; Q9UHS2; Q9H6W3; Q8N930; Q6NSH2; Q2M2H8; Q5SR59; LY6E_HUMAN 27 Q8IY34; Q6XYE6; Q8IVW8; GCC1_HUMAN; LBH2_HUMAN; NEUU_HUMAN; Q71RC9; Q6P3S1; SC5A4_HUMAN; Q8WVS4; M3K2_HUMAN; Q4G186; Q572P5; CPNE8_HUMAN; ITM2B_HUMAN; Q6ZR04; Q6ZT02; TCP10_HUMAN; Q2HIZ2; Q86UC7; LRC24_HUMAN; Q3SX69; Q5JXA9; Q96CG5; Q5JZG9; MYO3B_HUMAN; Q15156; Q86TU2; Q9Y5L9; CG010_HUMAN; Q86VM9;...”
• Oligopeptide/Histidine Transporter PHT1 and PHT2 - Function, Regulation, and Pathophysiological Implications Specifically in Immunoregulation.
  Dong, Pharmaceutical research 2023 (PubMed)
  • GeneRIF: Oligopeptide/Histidine Transporter PHT1 and PHT2 - Function, Regulation, and Pathophysiological Implications Specifically in Immunoregulation.
• The proton-coupled oligopeptide transporters PEPT2, PHT1 and PHT2 mediate the uptake of carnosine in glioblastoma cells.
  Oppermann, Amino acids 2019 (PubMed)
  • GeneRIF: The transporters PEPT2, PHT1, and PHT2 are responsible for the uptake of carnosine into glioblastoma cells and full function of all three transporters is required for maximum uptake.
• Substrate Transport Properties of the Human Peptide/Histidine Transporter PHT2 in Transfected MDCK Cells.
  Wang, Journal of pharmaceutical sciences 2019 (PubMed)
  • GeneRIF: Substrate Transport Properties of the Human Peptide/Histidine Transporter PHT2 in Transfected MDCK Cells.
• The Solute Carrier Transporter SLC15A3 Participates in Antiviral Innate Immune Responses against Herpes Simplex Virus-1.
  He, Journal of immunology research 2018
  • GeneRIF: Our results demonstrate that SLC15A3 is induced by viral infection to participate in intracellular RNA and DNA receptor-mediated interferon production
• Proton-coupled oligopeptide transporter (POT) family expression in human nasal epithelium and their drug transport potential.
  Agu, Molecular pharmaceutics 2011 (PubMed)
  • GeneRIF: PEPT1,PEPT2, PHT1, and PHT2 are expressed in human nasal epithelium.

XP_415099 solute carrier family 15 member 4 from Gallus gallus
47% identity, 99% coverage

• Expression of the peptide transporters PepT1, PepT2, and PHT1 in the embryonic and posthatch chick.
  Zwarycz, Poultry science 2013 (PubMed)
  • GeneRIF: The study profiled Peptide transporters 1 and 2 (PepT1 and PepT2) and peptide/histidine transporter 1 (PHT1) mRNA expression in various organs in layer chicks on embryonic d 18 and 20 and d 1, 3, 7, 10, and 14 posthatch.[PepT1, PepT2, PHT1]

S15A4_MOUSE / Q91W98 Solute carrier family 15 member 4; Peptide/histidine transporter 1 from Mus musculus (Mouse) (see 13 papers)
48% identity, 98% coverage

• function: Proton-coupled amino-acid transporter that mediates the transmembrane transport of L-histidine and some di- and tripeptides from inside the lysosome to the cytosol, and plays a key role in innate immune response (PubMed:19570976, PubMed:21277849, PubMed:25238095, PubMed:27845049, PubMed:29305823). Able to transport a variety of di- and tripeptides, including carnosine and some peptidoglycans (PubMed:29784761). Transporter activity is pH-dependent and maximized in the acidic lysosomal environment (By similarity). Involved in the detection of microbial pathogens by toll-like receptors (TLRs) and NOD- like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand, and L-alanyl-gamma-D-glutamyl-meso- 2,6-diaminoheptanedioate (tri-DAP), the NOD1 ligand (PubMed:19570976, PubMed:23028315, PubMed:24695226, PubMed:25238095, PubMed:29784761). Required for TLR7, TLR8 and TLR9-mediated type I interferon (IFN-I) productions in plasmacytoid dendritic cells (pDCs) (PubMed:21045126, PubMed:23382217, PubMed:25238095, PubMed:30262916). Independently of its transporter activity, also promotes the recruitment of innate immune adapter TASL to endolysosome downstream of TLR7, TLR8 and TLR9: TASL recruitment leads to the specific recruitment and activation of IRF5 (By similarity). Required for isotype class switch recombination to IgG2c isotype in response to TLR9 stimulation (PubMed:25310967). Required for mast cell secretory-granule homeostasis by limiting mast cell functions and inflammatory responses (PubMed:29155995).
  catalytic activity: L-histidine(out) + n H(+)(out) = L-histidine(in) + n H(+)(in) (RHEA:76379)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + n H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + n H(+)(in) (RHEA:76371)
  catalytic activity: L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(out) + n H(+)(out) = L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(in) + n H(+)(in) (RHEA:64412)
  catalytic activity: glycylglycylglycine(out) + n H(+)(out) = glycylglycylglycine(in) + n H(+)(in) (RHEA:76391)
  catalytic activity: carnosine(out) + n H(+)(out) = carnosine(in) + n H(+)(in) (RHEA:76383)
  subunit: Interacts with TASL; leading to TASL recruitment to endolysosome.
  disruption phenotype: Mice are fertile and look healthy but display impaired cytokine production in dendritic cells (PubMed:21277849). Reduced uptake of L-histidine in brain (PubMed:27845049).

S15A4_RAT / O09014 Solute carrier family 15 member 4; Peptide/histidine transporter 1; rPHT1 from Rattus norvegicus (Rat) (see 2 papers)
NP_653359 solute carrier family 15 member 4 from Rattus norvegicus
49% identity, 94% coverage

• function: Proton-coupled amino-acid transporter that mediates the transmembrane transport of L-histidine and some di- and tripeptides from inside the lysosome to the cytosol, and plays a key role in innate immune response (PubMed:9092568). Able to transport a variety of di- and tripeptides, including carnosine and some peptidoglycans (By similarity). Transporter activity is pH-dependent and maximized in the acidic lysosomal environment (PubMed:9092568). Involved in the detection of microbial pathogens by toll-like receptors (TLRs) and NOD- like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand, and L-alanyl-gamma-D-glutamyl-meso- 2,6-diaminoheptanedioate (tri-DAP), the NOD1 ligand. Required for TLR7, TLR8 and TLR9-mediated type I interferon (IFN-I) productions in plasmacytoid dendritic cells (pDCs). Independently of its transporter activity, also promotes the recruitment of innate immune adapter TASL to endolysosome downstream of TLR7, TLR8 and TLR9: TASL recruitment leads to the specific recruitment and activation of IRF5 (By similarity). Required for isotype class switch recombination to IgG2c isotype in response to TLR9 stimulation. Required for mast cell secretory-granule homeostasis by limiting mast cell functions and inflammatory responses (By similarity).
  catalytic activity: L-histidine(out) + n H(+)(out) = L-histidine(in) + n H(+)(in) (RHEA:76379)
  catalytic activity: L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(out) + n H(+)(out) = L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(in) + n H(+)(in) (RHEA:64412)
  catalytic activity: glycylglycylglycine(out) + n H(+)(out) = glycylglycylglycine(in) + n H(+)(in) (RHEA:76391)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + n H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + n H(+)(in) (RHEA:76371)
  catalytic activity: carnosine(out) + n H(+)(out) = carnosine(in) + n H(+)(in) (RHEA:76383)
  subunit: Interacts with TASL; leading to TASL recruitment to endolysosome.
• Divergent developmental expression and function of the proton-coupled oligopeptide transporters PepT2 and PhT1 in regional brain slices of mouse and rat.
  Hu, Journal of neurochemistry 2014
  • GeneRIF: We found marked changes in protein expression and functional activity of PhT1 and PepT2, the former predominating in adult and the latter in neonate
• Functional expression of SLC15 peptide transporters in rat thyroid follicular cells.
  Romano, Molecular and cellular endocrinology 2010 (PubMed)
  • GeneRIF: These findings represent the first evidence that peptide transport via SLC15a1, 2, 3, and 4 occurs in thyroid follicular cells.

S15A4_BOVIN / A6QQL0 Solute carrier family 15 member 4; Peptide/histidine transporter 1 from Bos taurus (Bovine) (see paper)
48% identity, 97% coverage

• function: Proton-coupled amino-acid transporter that mediates the transmembrane transport of L-histidine and some di- and tripeptides from inside the lysosome to the cytosol, and plays a key role in innate immune response. Able to transport a variety of di- and tripeptides, including carnosine and some peptidoglycans (By similarity). Transporter activity is pH-dependent and maximized in the acidic lysosomal environment (By similarity). Involved in the detection of microbial pathogens by toll-like receptors (TLRs) and NOD-like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand, and L-alanyl-gamma-D-glutamyl-meso- 2,6-diaminoheptanedioate (tri-DAP), the NOD1 ligand. Required for TLR7, TLR8 and TLR9-mediated type I interferon (IFN-I) productions in plasmacytoid dendritic cells (pDCs). Independently of its transporter activity, also promotes the recruitment of innate immune adapter TASL to endolysosome downstream of TLR7, TLR8 and TLR9: TASL recruitment leads to the specific recruitment and activation of IRF5 (By similarity). Required for isotype class switch recombination to IgG2c isotype in response to TLR9 stimulation. Required for mast cell secretory-granule homeostasis by limiting mast cell functions and inflammatory responses (By similarity).
  catalytic activity: glycylglycylglycine(out) + n H(+)(out) = glycylglycylglycine(in) + n H(+)(in) (RHEA:76391)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + n H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + n H(+)(in) (RHEA:76371)
  catalytic activity: L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(out) + n H(+)(out) = L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(in) + n H(+)(in) (RHEA:64412)
  catalytic activity: carnosine(out) + n H(+)(out) = carnosine(in) + n H(+)(in) (RHEA:76383)
  catalytic activity: L-histidine(out) + n H(+)(out) = L-histidine(in) + n H(+)(in) (RHEA:76379)
  subunit: Interacts with TASL; leading to TASL recruitment to endolysosome.

S15A4_HUMAN / Q8N697 Solute carrier family 15 member 4; Peptide transporter 4; Peptide/histidine transporter 1; hPHT1 from Homo sapiens (Human) (see 7 papers)
TC 2.A.17.3.11 / Q8N697 Solute carrier family 15 member 4 (Peptide transporter 4) (Peptide/histidine transporter 1) (hPHT1) present in immune cells from Homo sapiens (see 6 papers)
NP_663623 solute carrier family 15 member 4 from Homo sapiens
49% identity, 93% coverage

• function: Proton-coupled amino-acid transporter that mediates the transmembrane transport of L-histidine and some di- and tripeptides from inside the lysosome to the cytosol, and plays a key role in innate immune response (PubMed:16289537, PubMed:25238095, PubMed:29224352). Able to transport a variety of di- and tripeptides, including carnosine and some peptidoglycans (PubMed:29224352, PubMed:31073693). Transporter activity is pH-dependent and maximized in the acidic lysosomal environment (By similarity). Involved in the detection of microbial pathogens by toll-like receptors (TLRs) and NOD-like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand, and L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptanedioate (tri-DAP), the NOD1 ligand (PubMed:25238095, PubMed:29224352). Required for TLR7, TLR8 and TLR9-mediated type I interferon (IFN-I) productions in plasmacytoid dendritic cells (pDCs) (PubMed:25238095). Independently of its transporter activity, also promotes the recruitment of innate immune adapter TASL to endolysosome downstream of TLR7, TLR8 and TLR9: TASL recruitment leads to the specific recruitment and activation of IRF5 (PubMed:32433612). Required for isotype class switch recombination to IgG2c isotype in response to TLR9 stimulation (By similarity). Required for mast cell secretory-granule homeostasis by limiting mast cell functions and inflammatory responses (By similarity).
  catalytic activity: glycylglycylglycine(out) + n H(+)(out) = glycylglycylglycine(in) + n H(+)(in) (RHEA:76391)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + n H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + n H(+)(in) (RHEA:76371)
  catalytic activity: L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(out) + n H(+)(out) = L-alanyl-gamma-D-glutamyl-meso-diaminoheptanedioate(in) + n H(+)(in) (RHEA:64412)
  catalytic activity: carnosine(out) + n H(+)(out) = carnosine(in) + n H(+)(in) (RHEA:76383)
  catalytic activity: L-histidine(out) + n H(+)(out) = L-histidine(in) + n H(+)(in) (RHEA:76379)
  subunit: Interacts with TASL; leading to TASL recruitment to endolysosome.
• substrates: Histidine, peptides
• Structural basis for recruitment of TASL by SLC15A4 in human endolysosomal TLR signaling.
  Chen, Nature communications 2023
  • “...ordered from Hyclone. Construct and cell culture The codon-optimized cDNAs for human full-length SLC15A4 (Uniprot: Q8N697 [ https://www.uniprot.org/uniprotkb/Q8N697/entry ]), human TASL (Uniprot: Q9HAI6 [ https://www.uniprot.org/uniprotkb/Q9HAI6/entry ]) and the ALFA nanobody 41 were synthesized and validated by sequencing. The constructs for protein expression and cell-based assays were...”
  • “...in this study are available at Uniprot ( https://www.uniprot.org/ ) with the following accession codes: Q8N697 for human SLC15A4; Q9HAI6 for human TASL; P46059 for Human SLC15A1; Q16348 for Human SLC15A2; Q8IY34 for Human SLC15A3; Q91W98 for mouse SLC15A4; O09014 for rat SLC15A4; A6QQL0 for bovin...”
• Molecular basis of TASL recruitment by the peptide/histidine transporter 1, PHT1.
  Custódio, Nature communications 2023
  • “...The genes encoding the full-length chicken PHT1 (Uniprot accession number F1NG54), full-length human PHT1(accession number Q8N697), full-length PHT2 (accession number Q8IY34), full-length chicken TASL (Uniprot accession number A0A1L1RS25) and full-length human TASL (Uniprot accession number Q9HAI6) were inserted into an expression construct based on the pXLG...”
  • “...with the following accession codes: chicken PHT1 (Uniprot accession number F1NG54), human PHT1 (accession number Q8N697), PHT2 (accession number Q8IY34), chicken TASL (Uniprot accession number A0A1L1RS25), human TASL (Uniprot accession number Q9HAI6), human SLC15A5 (accession number A6NIM6), human Pept1 (accession number P46059) and human PepT2 (accession...”
• Comprehensive proteogenomic analysis of human embryonic and induced pluripotent stem cells.
  Parrotta, Journal of cellular and molecular medicine 2019
  • “...H0YMB3 GMPR2 GMP reductase 0.62 0.69 0.030 P00558 PGK1 Phosphoglycerate kinase 1 0.62 0.69 0.034 Q8N697 SLC15A4 Solute carrier family 15 member 4 0.61 0.70 0.004 O60637 TSPAN3 Tetraspanin3 0.61 0.71 0.007 P00338 LDHA Llactate dehydrogenase A chain 0.61 0.71 0.027 P13284 IFI30 Gammainterferoninducible lysosomal thiol...”
• THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
  Alexander, British journal of pharmacology 2017
  • “...SLC15A3 SLC15A4 HGNC, UniProt SLC15A1 , P46059 SLC15A2 , Q16348 SLC15A3 , Q8IY34 SLC15A4 , Q8N697 Common abreviation PepT1 PepT2 PHT2 PHT1 Substrates fMetLeuPhe [ 375 , 576 ], HisLeulopinavir [ 367 ], DAlaLysAMCA [ 319 , 508 ], AlaLysAMCA [ 3 , 319 ], muramyl...”
• The Concise Guide to PHARMACOLOGY 2015/16: Transporters
  Alexander, British journal of pharmacology 2015
  • “...PHT2 PHT1 HGNC, UniProt SLC15A1 , P46059 SLC15A2 , Q16348 SLC15A3 , Q8IY34 SLC15A4 , Q8N697 Substrates fMetLeuPhe [ 337 ], cefadroxil [ 177 ], valacyclovir [ 178 ], cyclacillin [ 177 ], muramyl dipeptide [ 496 ] cefadroxil [ 177 ], cyclacillin [ 177 ]...”
• The Concise Guide to PHARMACOLOGY 2013/14: transporters
  Alexander, British journal of pharmacology 2013
  • “...Common abbreviation PepT1 PepT2 PHT2 PHT1 HGNC, UniProt SLC15A1, P46059 SLC15A2, Q16348 SLC15A3, Q8IY34 SLC15A4, Q8N697 Endogenous substrates 5-aminolevulinic acid 253 , dipeptides 253 , tripeptides 253 5-aminolevulinic acid, dipeptides, tripeptides L-histidine, carnosine, dipeptides, tripeptides L-histidine, carnosine, dipeptides, tripeptides Substrates fMet-Leu-Phe 260 , cyclacillin 254 ,...”
• Oligopeptide/Histidine Transporter PHT1 and PHT2 - Function, Regulation, and Pathophysiological Implications Specifically in Immunoregulation.
  Dong, Pharmaceutical research 2023 (PubMed)
  • GeneRIF: Oligopeptide/Histidine Transporter PHT1 and PHT2 - Function, Regulation, and Pathophysiological Implications Specifically in Immunoregulation.
• A conformation-locking inhibitor of SLC15A4 with TASL proteostatic anti-inflammatory activity.
  Boeszoermenyi, Nature communications 2023
  • GeneRIF: A conformation-locking inhibitor of SLC15A4 with TASL proteostatic anti-inflammatory activity.
• Structural basis for recruitment of TASL by SLC15A4 in human endolysosomal TLR signaling.
  Chen, Nature communications 2023
  • GeneRIF: Structural basis for recruitment of TASL by SLC15A4 in human endolysosomal TLR signaling.
• Whole exome sequencing identifies novel germline variants of SLC15A4 gene as potentially cancer predisposing in familial colorectal cancer.
  Skopelitou, Molecular genetics and genomics : MGG 2022
  • GeneRIF: Whole exome sequencing identifies novel germline variants of SLC15A4 gene as potentially cancer predisposing in familial colorectal cancer.
• Identification of SLC15A4/PHT1 Gene Products Upregulation Marking the Intestinal Epithelial Monolayer of Ulcerative Colitis Patients.
  Mazzei, International journal of molecular sciences 2022
  • GeneRIF: Identification of SLC15A4/PHT1 Gene Products Upregulation Marking the Intestinal Epithelial Monolayer of Ulcerative Colitis Patients.
• Human SLC15A4 is crucial for TLR-mediated type I interferon production and mitochondrial integrity.
  Kobayashi, International immunology 2021 (PubMed)
  • GeneRIF: Human SLC15A4 is crucial for TLR-mediated type I interferon production and mitochondrial integrity.
• TASL is the SLC15A4-associated adaptor for IRF5 activation by TLR7-9.
  Heinz, Nature 2020
  • GeneRIF: identification of TASL as the component that links endolysosomal TLRs to the IRF5 transcription factor via SLC15A4 provides a mechanistic explanation for the involvement of these proteins in systemic lupus erythematosus
• The proton-coupled oligopeptide transporters PEPT2, PHT1 and PHT2 mediate the uptake of carnosine in glioblastoma cells.
  Oppermann, Amino acids 2019 (PubMed)
  • GeneRIF: The transporters PEPT2, PHT1, and PHT2 are responsible for the uptake of carnosine into glioblastoma cells and full function of all three transporters is required for maximum uptake.
• More

8qskA / Q8N697 Cryo-em structure of human slc15a4 dimer in outward open state in msp1d1 nanodisc
50% identity, 91% coverage

• Ligand: cholesterol hemisuccinate (8qskA)

8jzsB / Q8N697 Outward-facing slc15a4 dimer (see paper)
49% identity, 91% coverage

• Ligand: cholesterol (8jzsB)

XP_006504334 solute carrier family 15 member 4 isoform X1 from Mus musculus
42% identity, 98% coverage

• The solute carrier SLC15A4 is required for optimal trafficking of nucleic acid-sensing TLRs and ligands to endolysosomes.
  Rimann, Proceedings of the National Academy of Sciences of the United States of America 2022
  • GeneRIF: The solute carrier SLC15A4 is required for optimal trafficking of nucleic acid-sensing TLRs and ligands to endolysosomes.
• The phagosomal solute transporter SLC15A4 promotes inflammasome activity via mTORC1 signaling and autophagy restraint in dendritic cells.
  López-Haber, The EMBO journal 2022
  • GeneRIF: The phagosomal solute transporter SLC15A4 promotes inflammasome activity via mTORC1 signaling and autophagy restraint in dendritic cells.
• The peptide symporter SLC15a4 is essential for the development of systemic lupus erythematosus in murine models.
  Katewa, PloS one 2021
  • GeneRIF: The peptide symporter SLC15a4 is essential for the development of systemic lupus erythematosus in murine models.
• SLC15A2 and SLC15A4 Mediate the Transport of Bacterially Derived Di/Tripeptides To Enhance the Nucleotide-Binding Oligomerization Domain-Dependent Immune Response in Mouse Bone Marrow-Derived Macrophages.
  Hu, Journal of immunology (Baltimore, Md. : 1950) 2018
  • GeneRIF: this study shows that SLC15A4 mediates the transport of bacterially derived di/tripeptides to enhance the nucleotide-binding oligomerization domain-dependent immune response in mouse bone marrow-derived macrophages
• A requirement for slc15a4 in imiquimod-induced systemic inflammation and psoriasiform inflammation in mice.
  Griffith, Scientific reports 2018
  • GeneRIF: A requirement for slc15a4 in imiquimod-induced systemic inflammation and psoriasiform inflammation in mice.
• Lysosome biogenesis regulated by the amino-acid transporter SLC15A4 is critical for functional integrity of mast cells.
  Kobayashi, International immunology 2017
  • GeneRIF: this study demonstrated that SLC15A4 is required for mast-cell secretory-granule homeostasis, and limits mast-cell functions and inflammatory responses by controlling the mTORC1-TFEB signaling axis
• Slc15a4 function is required for intact class switch recombination to IgG2c in response to TLR9 stimulation.
  Dosenovic, Immunology and cell biology 2015 (PubMed)
  • GeneRIF: Slc15a4 is required for intact function of TLR9-expressing cells and for effective antibody isotype switching to IgG2c.
• Divergent developmental expression and function of the proton-coupled oligopeptide transporters PepT2 and PhT1 in regional brain slices of mouse and rat.
  Hu, Journal of neurochemistry 2014
  • GeneRIF: We found marked changes in protein expression and functional activity of PhT1 and PepT2, the former predominating in adult and the latter in neonate
• More

8jzxA / Q8N697 Slc15a4 inhibitor complex (see paper)
53% identity, 44% coverage

• Ligands: cholesterol; 2-(4-ethoxyphenyl)-n-[3-[(2r)-2-methylpiperidin-1-yl]propyl]quinoline-4-carboxamide (8jzxA)

PTR5_ARATH / Q9LFB8 Protein NRT1/ PTR FAMILY 8.2; AtNPF8.2; Peptide transporter PTR5 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
Q9LFB8 bacterial ABC-type protein transporter (EC 7.4.2.5) from Arabidopsis thaliana (see paper)
TC 2.A.17.3.8 / Q9LFB8 The germinating pollen dipeptide/tripeptide transporter, PTR5 (Komarova et al., 2008). Transport is electrogenic and dependent on protons. Leak currents are inhibited by Phe-Ala when this peptide binds at the active site with high affinity (see 3 papers)
NP_195738 peptide transporter 5 from Arabidopsis thaliana
AT5G01180 PTR5 (PEPTIDE TRANSPORTER 5); dipeptide transporter/ transporter from Arabidopsis thaliana
26% identity, 91% coverage

• function: Peptide transporter. Mediates the transport of di- and tripeptides. High affinity transporter. Involved in the uptake of peptides during pollen germination and tube growth.
  disruption phenotype: No visible phenotype.
• substrates: dipeptides, tripeptides
• Functional properties of the Arabidopsis peptide transporters AtPTR1 and AtPTR5.
  Hammes, The Journal of biological chemistry 2010
  • GeneRIF: Functional properties of the Arabidopsis peptide transporters AtPTR1 and AtPTR5
• AtPTR1 and AtPTR5 transport dipeptides in planta.
  Komarova, Plant physiology 2008
  • GeneRIF: AtPTR5 mediates uptake of peptides during pollen germination, and functions in nitrogen transport during ovule and early seed development. [AtPTR5]
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...PTR1 At3g54140 NPF8 di-peptides [ 13 , 14 ]; MeJA [ 18 ] AtNPF8.2 PTR5 At5g01180 NPF8 di-peptides [ 14 ] AtNPF8.3 PTR2/NTR1 At2g02040 NPF8 di-peptides [ 15 , 16 ]; histidine [ 63 ] O.sativa OsNPF2.2 OsPTR2 Os12g44100 NPF21 NO 3 [ 64 ] OsNPF2.4...”
• TSLRF: Two-Stage Algorithm Based on Least Angle Regression and Random Forest in genome-wide association studies
  Sun, Scientific reports 2019
  • “...SVR and EMMAX, the genes with the highest ranking were gene AT3G13530, AT1G03457, AT5G06500 and AT5G01180, ranked 4th, 3rd, 3rd and 5th, respectively. It means that top 2, 3 or 4 SNPs detected by these methods seem to be less important from the perspective of confirmed...”
• Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes
  Yong-Villalobos, Plant signaling & behavior 2016
  • “...Locus ID AT1G20840 AT1G32450 AT2G13540 AT4G35090 AT5G01180 AT1G47960 AT1G74590 AT2G16430 AT4G37670 AT5G22300 AT2G26760 AT3G02850 AT3G21870 AT3G60840 AT4G01820...”
• The paralogous R3 MYB proteins CAPRICE, TRIPTYCHON and ENHANCER OF TRY AND CPC1 play pleiotropic and partly non-redundant roles in the phosphate starvation response of Arabidopsis roots
  Chen, Journal of experimental botany 2015
  • “...At2g46570 LACCASE 6 (LAC6) 2.62 At3g24518 At3g24520 HEAT SHOCK TRANSCRIPTION FACTOR C1 (HSFC1) 0.40 At5g01175 At5g01180 PEPTIDE TRANSPORTER 5 (PTR5) 1.59 At1g28685 At1g28680 HXXXD-type acyl-transferase family protein 0.38 At2g35738 At2g35740 INOSITOL TRANSPORTER 3 (INT3) 0.49 At2g35637 At2g35640 Homeodomain-like superfamily protein 0.43 At1g60525 At1g60530 DYNAMIN RELATED PROTEIN...”
• Overexpression of Fatty Acid Amide Hydrolase Induces Early Flowering in Arabidopsis thaliana
  Teaster, Frontiers in plant science 2012
  • “...PR-6 proteinase inhibitor family 2.25 At1g01670 RING/U-box superfamily protein; functions in: ubiquitin-protein ligase activity 2.25 At5g01180 Encodes a dipeptide transporter expressed in pollen and ovules during early seed development 2.22 At2g24960 Unknown protein 2.19 At5g58310 Encodes a protein shown to have methyl IAA esterase activity in...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...and SA were both involved in regulation of it [ 12 , 13 ]. AtPTR5 (At5g01180) which mediated high-affinity transport of dipeptides was most likely supplying peptides to maturating pollen, developing ovules and seeds. Overexpression of it resulted in enhanced shoot growth and increased N content...”
  • “...the AtPTR genes had relatively low expression level in mature pollen except At1g62200, At5g28470 and At5g01180. These genes were most likely supplying nutrition to maturating pollen. Some of the orthologous OsPTR and AtPTR genes showed the similar expression pattern such as Os06g15370 and At1g68570, Os05g27010 and...”

PTR1_ARATH / Q9M390 Protein NRT1/ PTR FAMILY 8.1; AtNPF8.1; Peptide transporter PTR1 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
Q9M390 bacterial ABC-type protein transporter (EC 7.4.2.5) from Arabidopsis thaliana (see paper)
TC 2.A.17.3.7 / Q9M390 The root dipeptide/tripeptide transporter, PTRI (Komarova et al., 2008). Transport is electrogenic and dependent on protons. Leak currents are inhibited by Phe-Ala when this peptide binds at the active site with high affinity from Arabidopsis thaliana (see 4 papers)
NP_190982 peptide transporter 1 from Arabidopsis thaliana
AT3G54140 PTR1 (PEPTIDE TRANSPORTER 1); dipeptide transporter/ transporter/ tripeptide transporter from Arabidopsis thaliana
27% identity, 94% coverage

• function: Peptide transporter. Mediates the transport of di- and tripeptides. High affinity transporter with low selectivity. No transport of amino acids.
  disruption phenotype: Reduced growth and lower N content when cultivated on dipeptides. No effect on germination.
• substrates: dipeptides, tripeptides
• Integrated Transcriptional and Proteomic Profiling Reveals Potential Amino Acid Transporters Targeted by Nitrogen Limitation Adaptation
  Liao, International journal of molecular sciences 2020
  • “...protein S27a-2 1.61 0.005 P25865 Ubiquitin-conjugating enzyme E2 1 1.52 0.004 Nitrogen metabolism and transport Q9M390 Protein NRT1/PTR FAMILY 8.1 1.67 0.003 P11832 Nitrate reductase [NADH] 1 1.81 0.008 O04907 Nitrilase 2 1.88 0.030 A0A178UFA7 LHT1 2.09 0.003 Q9FGS5 High-affinity nitrate transporter 3.1 2.15 0.027 a...”
• Transcriptomic features of Pecten maximus oocyte quality and maturation.
  Pauletto, PloS one 2017
  • “...0.94 Transposable element Tcb2 transposase (Q04202) 0.94 Heparanase (Q9Y251) 0.94 Protein NRT1/ PTR FAMILY 8.1 (Q9M390) 0.94 Dual specificity testis-specific protein kinase 2 (Q924U5) 0.94 Protein FAM179B (Q6A070) 0.93 Heparan-sulfate 6-O-sulfotransferase 1 (O60243) 0.93 Importin-4 (Q8VI75) 0.93 E3 ubiquitin-protein ligase MIB2 (Q5ZIJ9) 0.93 Phosphatidylinositol-binding clathrin assembly...”
• Method to increase the yield of eukaryotic membrane protein expression in Saccharomyces cerevisiae for structural and functional studies
  Parker, Protein science : a publication of the Protein Society 2014
  • “...Protein abbreviation Protein name Uniprot identifier Predicted TM helices Mass (KDa) AtPTR1 Arabidopsis thaliana PTR1 Q9M390 12 64 ScVRG4 Saccharomyces cerevisiae VRG4 P40107 10 37 AtNRT1.1 A. thaliana NRT1.1 Q05085 12 64.9 SlCAT9 Solanum lycopersicum CAT9 K4CYY3 13 60.4 ScAVT1 S. cerevisiae AVT1 P47082 11 65.3...”
• Functional properties of the Arabidopsis peptide transporters AtPTR1 and AtPTR5.
  Hammes, The Journal of biological chemistry 2010
  • GeneRIF: Functional properties of the Arabidopsis peptide transporters AtPTR1 and AtPTR5
• AtPTR1, a plasma membrane peptide transporter expressed during seed germination and in vascular tissue of Arabidopsis.
  Dietrich, The Plant journal : for cell and molecular biology 2004 (PubMed)
  • GeneRIF: A new transporter mediating the uptake of di- and tripeptides was isolated from Arabidopsis thaliana. [AtPTR1]
• Membrane nanodomains and transport functions in plant
  Martinière, Plant physiology 2021
  • “...transporter (ENT) AT4G05120 (ENT3) Suspension cell cultures Keinath et al., 2010 Peptides Peptide transporter (PTR) AT3G54140 (PTR1); AT2G02040 (PTR2) Suspension cell cultures Keinath et al., 2010 ; Yoshida et al., 2013 Oligopeptide transporter (OPT) AT5G64410 (OPT4) Suspension cell cultures Keinath et al., 2010 0 Phosphate Phosphate...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...NRT1.5 At1g32450 NPF7 NO 3 [ 53 ]; K + [ 23 ] AtNPF8.1 PTR1 At3g54140 NPF8 di-peptides [ 13 , 14 ]; MeJA [ 18 ] AtNPF8.2 PTR5 At5g01180 NPF8 di-peptides [ 14 ] AtNPF8.3 PTR2/NTR1 At2g02040 NPF8 di-peptides [ 15 , 16 ]; histidine...”
• Genome-Wide Transcriptome Analysis Reveals Conserved and Distinct Molecular Mechanisms of Al Resistance in Buckwheat (Fagopyrum esculentum Moench) Leaves
  Chen, International journal of molecular sciences 2017
  • “...malate transporter family protein Malate comp33002_c0_seq1 1.168 AT1G77210 Sugar transport protein 14 Monosaccharide comp5166_c0_seq1 1.145 AT3G54140 Peptide transporter 1 Peptide comp15597_c0_seq1 1.121 AT2G38940 Phosphate transporter 1;4 Pi comp14809_c0_seq1 1.128 comp32347_c0_seq1 1.111 AT3G26570 Phosphate transporter 2;1 Pi comp22508_c0_seq1 1.293 AT5G43350 Phosphate transporter 1 Pi comp26614_c0_seq1 1.078 AT5G54800...”
• Comparative transcriptome profiling of the fertile and sterile flower buds of a dominant genic male sterile line in sesame (Sesamum indicum L.)
  Liu, BMC plant biology 2016
  • “...488 AtSPO11-1, AtTAF6 ATSPO11-1 SIN_1025211 1.52 AT5G22130 6E-110 329 PNT1 PEANUT 1 (PNT1) SIN_1015023 1.49 AT3G54140 0 768 ATPTR1, PTR1 peptide transporter 1 (PTR1) SIN_1008202 1.36 AT4G39400 1.6 26.2 BIN1, BRI1, DWF2 BRASSINOSTEROID INSENSITIVE 1 (BRI1) SIN_1008272 1.30 AT3G48750 2E-91 280 CDC2, CDK2 cell division control...”
• Fluorescent sensors for activity and regulation of the nitrate transceptor CHL1/NRT1.1 and oligopeptide transporters
  Ho, eLife 2014
  • “...was performed using Phyre ( Kelley and Sternberg, 2009 ). Full-length CHL1 (At1g12110) and AtPTR1/NPF8.1 (At3g54140) amino acid sequences were used for the 3D structure prediction on the website. The analysis made use of four solved crystal structures of nitrate/peptide homologs (PDB ID: 4iky, 2xut, 4aps,...”
• PAMP (pathogen-associated molecular pattern)-induced changes in plasma membrane compartmentalization reveal novel components of plant immunity
  Keinath, The Journal of biological chemistry 2010
  • “...AT5G40780 LHT1 (lysine histidine transporter 1) AT3G54140 PTR1 (peptide transporter 1) Cell wall-related AT1G03870 FLA9 (fasciclin-like arabinogalactan 9)...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...AtPTR2 exhibited delayed flowering time and arrested seed development [ 9 , 11 ]. AtPTR1 (At3g54140) transported di-/tripeptides with low selectivity as well as substrates lacking a peptide bond. AtPTR1 was expressed in the vascular tissue throughout the plant, indicative of a role in long-distance transport...”
• Enigma variations for peptides and their transporters in higher plants
  Waterworth, Annals of botany 2006
  • “...AT3G25260 AT3G45690 AT5G13400 NTL1 AT1G69850 AT3G45680 AT3G54140 PTR1 AT5G01180 AT2G02040 PTR2 AT1G27040 AT5G62730 II AT2G02020 AT1G33440 AT1G59740 AT2G40460...”
  • “...subfamily IV, PTR3 (AT5G46050) in subfamily III and PTR1 (AT3G54140) and PTR2 (AT2G02040) in subfamily II are indicated. in yeast or Xenopus oocytes (Rentsch et...”
• More

PTR26_ARATH / Q84WG0 Protein NRT1/ PTR FAMILY 8.4; AtNPF8.4; Peptide transporter PTR4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
Q84WG0 bacterial ABC-type protein transporter (EC 7.4.2.5) from Arabidopsis thaliana (see paper)
AT2G02020 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
NP_178311 Major facilitator superfamily protein from Arabidopsis thaliana
28% identity, 91% coverage

• Transcriptomic Landscape of Herbivore Oviposition in Arabidopsis: A Systematic Review
  Ojeda-Martinez, Frontiers in plant science 2021
  • “...2014 ). Other mechanisms associated with molecule trafficking were represented by genes such as PTR4 (AT2G02020) and SAR1 (AT2G33120) ( Zhang et al., 2011 ; Komarova et al., 2012 ). P. brassicae response involved TFs such as HAF01 (AT1G32750) and E2F3 (AT2G36010) ( Magyar et al.,...”
• Nitrate Uptake Affects Cell Wall Synthesis and Modeling
  Landi, Frontiers in plant science 2017
  • “...allocation into the vacuoles was assisted by peptide transporters ( PTRs ), such as, AtPTR4 (At2g02020) and AtPTR6 (At1g62200); these proteins showed vacuole specific localization, thus playing a role in nitrate storage in the plant cell (Weichert et al., 2012 ). Fan et al. ( 2017...”
• AtPTR4 and AtPTR6 are differentially expressed, tonoplast-localized members of the peptide transporter/nitrate transporter 1 (PTR/NRT1) family.
  Weichert, Planta 2012 (PubMed)
  • GeneRIF: AtPTR4 is expressed in the plant vasculature.

LOC105156148 protein NRT1/ PTR FAMILY 8.3 from Sesamum indicum
27% identity, 91% coverage

• Genome-wide association analysis uncovers the genetic architecture of tradeoff between flowering date and yield components in sesame
  Sabag, BMC plant biology 2021
  • “...most of the CGs were involved in signaling pathways and regulation and four of them (LOC105156148, LOC105156152, LOC105156159, and LOC105156313) were associated with controlling flowering time, floral development, and productivity in Arabidopsis and rice [ 46 49 ]. Discussion Understanding the genetic basis of agronomic traits...”
  • “...within this genomic region highlighted 20 flowering and productivity-related genes (Supplemental Table S 10 ). LOC105156148 is encoding nitrate transporter (NRT1) and was found in Arabidopsis to interact with two flowering regulators transcription factors, CONSTANS and FLOWERING LOCUS C (FLC) [ 49 ]. LOC105156159 is encoding...”

LOC21395522 protein NRT1/ PTR FAMILY 5.1 from Morus notabilis
27% identity, 97% coverage

• Soil Application of Bacillus subtilis Regulates Flavonoid and Alkaloids Biosynthesis in Mulberry Leaves
  Yu, Metabolites 2024
  • “...10 DEGs, including LOC21396121 (gibberellin-44 dioxygenase), LOC21386582 (multidrug resistance protein), LOC21409922 (heat shock transcription factor), LOC21395522 (peptide/histidine transporter) and novel2146 (serine/threonine-protein kinase PBS1), were related to plantpathogen interaction and the biosynthesis of secondary metabolites. Pearsons correlation analysis demonstrated a significant association between the DSMs and DEGs...”

M8C905 Nitrate/chlorate transporter from Aegilops tauschii
26% identity, 84% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
  Santi, Frontiers in plant science 2017
  • “...GRMZM2G061495_T01 Q7XMZ2 OSJNBa0027G07.3 protein 3.20 GRMZM5G865543_T01 B6SUB5 Electron carrier/electron transporter/iron ion binding protein 3.16 GRMZM2G476069_T01 M8C905 Nitrate/chlorate transporter 2.89 GRMZM2G057611_T01 Q67VA9 Putative oligopeptide transporter 2.85 GRMZM2G423884_T01 K7V9U9 Protein detoxification 2.79 GRMZM2G519761_T01 K7UHM7 Uncharacterized protein 2.64 GRMZM2G055834_T01 Q852B2 Os03g0823500 protein 2.64 GRMZM2G020859_T01 B6SV43 Potassium channel AKT2/3 2.36...”

PTR46_ARATH / Q9M1I2 Protein NRT1/ PTR FAMILY 5.4; AtNPF5.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G54450 transporter from Arabidopsis thaliana
24% identity, 94% coverage

• Pre-symptomatic transcriptome changes during cold storage of chilling sensitive and resistant peach cultivars to elucidate chilling injury mechanisms
  Pons, BMC genomics 2015
  • “...transporter OPT superfamily AT5G55930 OPT1 PPN035B10 Oligopeptide transporter 7 AT4G10770 OPT7 PPN057F10 Oligopeptide transporter-like protein AT3G54450 k - means 11. Associated with high sensitivity to FB Aminoacid metabolism GABA biosynthesis PPN044B12 Glutamate decarboxylase, putative AT3G17760 GAD5 Pyruvate and Reactive carbonyl species Conversion of oxalacetate to PEP...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...in 24 development stages released the expression profile of 51 genes except At1g72125, At3g45660 and At3g54450 (Additional file 7 ). Obviously, the expression patterns of AtPTR genes fell into the similar groups as OsPTR genes. Some tissue-specific expression AtPTR genes could also be identified, for example,...”

LOC4336852 protein NRT1/ PTR FAMILY 8.3 from Oryza sativa Japonica Group
27% identity, 94% coverage

• Functional analysis of the OsNPF4.5 nitrate transporter reveals a conserved mycorrhizal pathway of nitrogen acquisition in plants
  Wang, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...OsHA1 (LOC4331281), OsNAR2.1 (LOC4329861), OsNRT2.1 (LOC4328051), OsNRT2.2 (LOC4328052), OsNPF1.3 (LOC4327022), OsNPF5.4 (LOC4348864), OsNPF7.2 (LOC4330372), OsNPF8.3 (LOC4336852), OsAMT3.1 (LOC107276856), OsNR1 (LOC4330867), OsNR2 (LOC4345798), OsGS1.1 (LOC4330649), MtNPF4.5 (LOC11406786), ZmNPF4.5 (LOC103652484), and SbNPF4.5 (LOC8062188). Supplementary Material Supplementary File Supplementary File This work was supported by National Key Research and...”

PTR2_ARATH / P46032 Protein NRT1/ PTR FAMILY 8.3; AtNPF8.3; Histidine-transporting protein; Peptide transporter PTR2 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
TC 2.A.17.3.2 / P46032 Histidine or peptide:H+ symporter from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
PTR2-B / AAB00858.1 transport protein from Arabidopsis thaliana (see paper)
NP_178313 peptide transporter 2 from Arabidopsis thaliana
AT2G02040 PTR2 (PEPTIDE TRANSPORTER 2); dipeptide transporter/ high affinity oligopeptide transporter/ nitrate transmembrane transporter/ peptide transporter/ transporter/ tripeptide transporter from Arabidopsis thaliana
26% identity, 91% coverage

• function: Peptide transporter. Mediates the transport of di- and tripeptides. High affinity, low capacity transporter. Can also transport histidine
• substrates: H+, Histidine, peptides
• Plasma membrane aquaporins mediates vesicle stability in broccoli
  Martínez-Ballesta, PloS one 2018
  • “...ATPase 2, plasma membrane-type 4,64 25 Q42556 954 105141,76 ATPase 9, plasma membrane-type 2,41 7 P46032 585 64379,59 Peptide transporter PTR2 2,22 1 P83970 951 104618,27 Plasma membrane ATPase 2,42 3 P23586 522 57572,98 Sugar transport protein 1 2,30 Q9SZN1 487 54270,67 V-type proton ATPase subunit...”
• Peptide transporter2 (PTR2) enhances water uptake during early seed germination in Arabidopsis thaliana.
  Choi, Plant molecular biology 2020
  • GeneRIF: PTR2 in Arabidopsis thaliana is negatively regulated by ABI4 and plays a key role in water uptake by seeds, ensuring that imbibed seeds proceed to germination.
• Spliceosome disassembly factors ILP1 and NTR1 promote miRNA biogenesis in Arabidopsis thaliana.
  Wang, Nucleic acids research 2019
  • GeneRIF: Spliceosome disassembly factors ILP1 and NTR1 promote miRNA biogenesis in Arabidopsis thaliana.
• Membrane nanodomains and transport functions in plant
  Martinière, Plant physiology 2021
  • “...AT4G05120 (ENT3) Suspension cell cultures Keinath et al., 2010 Peptides Peptide transporter (PTR) AT3G54140 (PTR1); AT2G02040 (PTR2) Suspension cell cultures Keinath et al., 2010 ; Yoshida et al., 2013 Oligopeptide transporter (OPT) AT5G64410 (OPT4) Suspension cell cultures Keinath et al., 2010 0 Phosphate Phosphate transporter (PHT)...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...]; MeJA [ 18 ] AtNPF8.2 PTR5 At5g01180 NPF8 di-peptides [ 14 ] AtNPF8.3 PTR2/NTR1 At2g02040 NPF8 di-peptides [ 15 , 16 ]; histidine [ 63 ] O.sativa OsNPF2.2 OsPTR2 Os12g44100 NPF21 NO 3 [ 64 ] OsNPF2.4 Os03g48180 NPF21 NO 3 [ 65 ] OsNPF7.2...”
• Genetic and Molecular Regulation of Seed Storage Proteins (SSPs) to Improve Protein Nutritional Value of Oilseed Rape (Brassica napus L.) Seeds
  Gacek, Frontiers in plant science 2018
  • “...et al., 2006 AT1G10010 AMINO ACID PERMEASE 8 Amino acid transport Schmidt et al., 2007 AT2G02040 PEPTIDE TRANSPORTER 2 Peptide transport Song et al., 1997 Synthesis of SSPs AT3G52850 VACUOLAR SORTING RECEPTOR 1 Protein targeting to vacuole, protein transport Zouhar et al., 2010 AT2G30290 VACUOLAR SORTING...”
• Pistil Transcriptome Analysis to Disclose Genes and Gene Products Related to Aposporous Apomixis in Hypericum perforatum L
  Galla, Frontiers in plant science 2017
  • “...P450, FAMILY 71, SUBFAMILY B, POLYPEPTIDE 2 defense response to other organism; heat acclimation isotig07093 AT2G02040 PTR2 Predicted protein peptide transport; protein transport isotig12044 AT1G53840 PME1 PECTIN METHYLESTERASE 1 cell wall modification; pectin catabolic process HHKO36P01BR1EE - - Unknown product n.a. HHKO36P01C9NWL AT4G34740 ASE2 DIFFERENTIAL DEVELOPMENT...”
• Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach
  Shaar-Moshe, BMC plant biology 2015
  • “...(AT3G05290, PNC1), loc_os08g06010 (AT3G47420, G3PP1), loc_os03g43720 (AT3G13050, NIAP), loc_os02g39930 (AT5G58070, ATTIL), loc_os04g36560 (chloride channel) loc_os10g22560 (AT2G02040, PTR2-B), loc_os04g57200 (metal ion transport) Metal handling Metal binding loc_os04g17100 (AT5G66110, metal ion binding), loc_os04g32030 (AT5G50740, metal ion binding) Cell Organization loc_os07g37560 (AT1G50360, VIIIA) loc_os07g38730 (AT5G19780, TUA5) Death loc_os03g05310 (AT3G44880,...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...of their substrates: di-/tripeptides transporter, nitrate transporter and other substrates transporter [ 6 ]. AtPTR2 (At2g02040) was the first identified di-/tripeptides transporter in Arabidopsis [ 7 - 10 ] and had high mRNA expression levels in 3-d-germinating seed, root and young leaf [ 8 ]. The...”
• Storage reserve accumulation in Arabidopsis: metabolic and developmental control of seed filling
  Baud, The arabidopsis book 2008
  • “...al., 2007). Beyond AAPs, the peptide transporter AtPTR2 (At2g02040) may participate in the supply of reduced organic nitrogen compounds to young developing...”
• A proteomics dissection of Arabidopsis thaliana vacuoles isolated from cell culture
  Jaquinod, Molecular & cellular proteomics : MCP 2007
  • “...5.2 At4g35300 5.4 At3g62700 8.8 63,376 79,674 172,027 At2g02040 At2g47800 At4g25640 At5g37640 At5g20650 At1g30400 At5g62740 5.5 7.6 6.1 5.8 9.1 5.9 5.3 64,380...”
  • “...NF NF At1g72140 61,347 8.2 12 34 POT 2d Transp. NF NF At2g02040 64,380 5.5 10 567 (19) 807 POT 2d Transp. 103 7 At3g27020 73,525 5.9 15 184 (9) 236 OPT 2d...”
• More

F2DQ88 Predicted protein from Hordeum vulgare subsp. vulgare
27% identity, 89% coverage

• Proteomic Analysis of Barley (Hordeum vulgare L.) Leaves in Response to Date Palm Waste Compost Application
  Ghouili, Plants (Basel, Switzerland) 2022
  • “...acid metabolism Down 0.55 F2DXZ9 Other pathways 44 Protein NRT1/PTR FAMILY Solute transport Down 0.56 F2DQ88 Other pathways 45 Saccharopine dehydrogenase-like protein Amino acid metabolism Down 0.56 K9JGW1 Biosynthesis of amino acids 46 Legumain Multi-process regulation Down 0.57 B4ESE3 Metabolic pathways 47 Non-specific lipid transfer protein...”

PTR30_ARATH / Q8VZR7 Protein NRT1/ PTR FAMILY 5.1; AtNPF5.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT2G40460 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
28% identity, 94% coverage

• Arabidopsis NPF5.1 regulates ABA homeostasis and seed germination by mediating ABA uptake into the seed coat
  Shimizu, Plant signaling & behavior 2022
  • “...software (SCIEX). Results and discussions We previously reported that the transporter encoded by Arabidopsis NPF5.1 (At2g40460) mediates cellular ABA uptake. 8 NPF5.1 is expressed in vascular tissues and leaf mesophyll and epidermal cells during vegetative stages. Mutants defective in NPF5.1 ( npf5.1 ) exhibited higher leaf...”
• Genetic Determinants of Fiber-Associated Traits in Flax Identified by Omics Data Integration
  Kanapin, International journal of molecular sciences 2022
  • “...wall localized proteins tightly associated to its loosening and stiffening Lus10029063 major facilitator superfamily protein AT2G40460 [ 43 ] facilitates movement of small solutes across cell membranes Chr4:17106278 Lus10004043 myb domain protein 20 AT1G66230 [ 87 ] activates lignin and phenylalanine biosynthesis genes during secondary wall...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...NPF4 NO 3 [ 59 ]; ABA [ 17 , 18 , 58 ] AtNPF5.1 At2g40460 NPF51 ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF5.2 PTR3 At5g46050 NPF51 ABA/GA 1/3/4 [ 9 ]; di-peptides [ 60 ] SA; MeJA; ABA AtNPF5.3 At5g46040 NPF51 ABA [ 18 ]...”
• Genome-wide identification, classification and transcriptional analysis of nitrate and ammonium transporters in Coffea
  Santos, Genetics and molecular biology 2017
  • “...was Cc02_g05650 , in agreement with the high expression profile of its ortholog oligopeptide transporter At2g40460 in Arabidopsis seeds ( von Wittgenstein et al ., 2014 ). These two genes are part of the super-group I, group I E ( Figure S2 ). The NRT2 family...”
• Regulation of transcription by the Arabidopsis UVR8 photoreceptor involves a specific histone modification
  Velanis, Plant molecular biology 2016
  • “...AT2G37970 SOUL heme-binding family protein Ch5 AT5G13930 CHS Chalcone and stilbene synthase family protein Chr2 AT2G40460 Major facilitator superfamily protein Ch5 AT5G17780 Alpha/beta-Hydrolases superfamily protein Chr3 AT3G10910 RING/U-box superfamily protein Ch5 AT5G19850 Alpha/beta-Hydrolases superfamily protein Chr3 AT3G14770 Nodulin MtN3 family protein Ch5 AT5G23730 RUP2 Transducin/WD40 repeat-like...”
• The circadian clock and defence signalling in plants
  Sharma, Molecular plant pathology 2015 (secret)
• Plant growth in Arabidopsis is assisted by compost soil-derived microbial communities
  Carvalhais, Frontiers in plant science 2013
  • “...(34.5%) 3815/29970 (12.7%) GT72B1, VTC2, RAP2.4, AT1G76190, CP12-2, HSF, A4A, AT1G70000, ATMRP7, CBL5, CRY1, AT2G31730, AT2G40460, STO, AT5G41750, AT3G23600, EBF1, PRXR1, RING1, YSL1 GO:0042221 response to chemical stimulus 4.36E-03 14/55 (25.5%) 1984/29970 (6.6%) GT72B1, VTC2, RAP2.4, CP12-2, HSF, A4A, AT1G70000, CBL5, AT2G31730, EBF1, PRXR1, RING1, YSL1...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...four pairs of orthologs (Os01g01360 and At5g13400, Os01g37590 and At2g26690, Os06g15370 and At1g68570, Os05g27010 and At2g40460) could be figured out. This result indicated that the main characteristics of PTR family in rice and Arabidopsis were formed before the split of monocotyledonous and dicotyledonous plants and then...”
  • “...and AtPTR genes showed the similar expression pattern such as Os06g15370 and At1g68570, Os05g27010 and At2g40460. They both had high expression level in all the tissues. However, no more apparent relationship between the expression pattern and sequence similarities of OsPTR and AtPTR members could be pointed...”
• More

PTR17_ARATH / Q93Z20 Protein NRT1/ PTR FAMILY 8.5; AtNPF8.5; Peptide transporter PTR6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
Q93Z20 bacterial ABC-type protein transporter (EC 7.4.2.5) from Arabidopsis thaliana (see paper)
AT1G62200 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
25% identity, 89% coverage

• Identification of Yellow Seed Color Genes Using Bulked Segregant RNA Sequencing in Brassica juncea L
  Wang, International journal of molecular sciences 2024
  • “...qSCA09-3 A09 14,667,647 14,669,807 67.84 165.38 BjuOA09G23850 AT5G47650 qSCA09-3 A09 15,097,228 15,100,123 13.20 0.00 BjuOA09G24380 AT1G62200 qSCA09-3 A09 16,516,247 16,518,639 28.12 1.67 BjuOA09G26270 AT4G04710 qSCA09-3 A09 16,848,640 16,849,093 52.31 110.67 BjuOA09G26840 AT1G64590 qSCA09-3 A09 16,951,516 16,952,504 44.29 108.10 BjuOA09G27000 AT4G12580 qSCA09-3 A09 12,155,595 12,157,288 5727.33 3.97...”
• Nitrate Uptake Affects Cell Wall Synthesis and Modeling
  Landi, Frontiers in plant science 2017
  • “...vacuoles was assisted by peptide transporters ( PTRs ), such as, AtPTR4 (At2g02020) and AtPTR6 (At1g62200); these proteins showed vacuole specific localization, thus playing a role in nitrate storage in the plant cell (Weichert et al., 2012 ). Fan et al. ( 2017 ) reported that...”
• Uncovering genes and ploidy involved in the high diversity in root hair density, length and response to local scarce phosphate in Arabidopsis thaliana
  Stetter, PloS one 2015
  • “...family protein 1 11670614 1.92E-07 At1G32350 upstream AOX1D , alternative oxidase 1D 1 22986142 7.24E-06 At1G62200 upstream PTR6 , peptide transporter 2 10855824 1.41E-05 At2G25500 upstream nosine triphosphate pyrophosphatase family protein 5 18375271 1.60E-05 At5G45340 upstream CYP707A3 1 21316400 1.91E-05 At1G57560 upstream MYB50 , transcription factor...”
• The response and recovery of the Arabidopsis thaliana transcriptome to phosphate starvation
  Woo, BMC plant biology 2012
  • “...also displayed a persistent negative response of 2.8 fold. By contrast, two peptide transporter genes, At1g62200 and At1g22550 , identified as members of the PPR class, have been implicated in zinc hyper-accumulation. And, the gene for another carnitine transporter, OCT4 , displayed a PPR pattern with...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...root. Most of the AtPTR genes had relatively low expression level in mature pollen except At1g62200, At5g28470 and At5g01180. These genes were most likely supplying nutrition to maturating pollen. Some of the orthologous OsPTR and AtPTR genes showed the similar expression pattern such as Os06g15370 and...”

PTR50_ARATH / Q9LFR1 Protein NRT1/ PTR FAMILY 5.8; AtNPF5.8 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT5G14940 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
26% identity, 95% coverage

• Two NPF transporters mediate iron long-distance transport and homeostasis in Arabidopsis
  Chen, Plant communications 2021
  • “...B). Given that functional redundancy might occur in NPF5.9 in regulating Fe-related phenotypes, and NPF5.8 (At5g14940) is the closest homologto NPF5.9 in the NPF family ( Supplemental Figure4 ), showing vasculature-specific expression pattern ( Supplemental Figure5 A5F) and similar subcellular localization ( Supplemental Figure5 G), we...”
• NPF transporters in synaptic-like vesicles control delivery of iron and copper to seeds
  Chao, Science advances 2021
  • “...NA in the medium cultivating yeast strains expressing AhNAS3 and an NPF family member NPF5.8 (At5g14940) or its close homolog NPF5.9 (At3g01350), indicating that the two genes encode proteins facilitating efflux of NA out of yeast cells ( Fig. 1C and fig. S2). The two proteins...”
• Shoot chloride exclusion and salt tolerance in grapevine is associated with differential ion transporter expression in roots
  Henderson, BMC plant biology 2014
  • “...family protein NG11_4749_12704 VIT_17s0000g05550 GSVIVT01008072001 AT3G47960 0.54 1.88E-04 Glucosinolate transporter 1 (GTR1) NG11_7897_10153 VIT_14s0066g02020 GSVIVT01032550001 AT5G14940 0.64 3.31E-07 Proton-dependent oligopeptide transport (POT) family protein NG11_35177_1429 VIT_18s0041g00670 GSVIVT01026058001 AT1G72140 0.89 7.91E-14 Proton-dependent oligopeptide transport (POT) family protein NG11_25530_14040 VIT_04s0008g03580 GSVIVT01035643001 AT1G22550 1.11 2.21E-24 Nitrate transporter 1.11 NG11_31776_20297...”

LOC107869375 protein NRT1/ PTR FAMILY 7.3 from Capsicum annuum
24% identity, 95% coverage

• Genome-Wide Association Study of Resistance to Phytophthora capsici in the Pepper (Capsicum spp.) Collection
  Ro, Frontiers in plant science 2022
  • “...* Alt. * Type Gene name/symbol Function Primer design chr01 18,309,131 3.12E-07 T A missense_variant LOC107869375 Protein NRT1/PTR FAMILY 7.3-like No chr01 18,541,809 5.90E-07 T A intergenic_region No chr01 18,541,871 5.37E-07 C G intergenic_region No chr02 112,632,207 4.85E-07 T C upstream_gene_variant LOC107858831 Protein WVD2-like 7 Yes...”

LOC100787705 protein NRT1/ PTR FAMILY 7.3 from Glycine max
26% identity, 92% coverage

• Transcriptome analysis and functional identification of GmMYB46 in soybean seedlings under salt stress
  Liu, PeerJ 2021
  • “...( LOC100807235, LOC100816551, LOC100785783, LOC100787314, LOC100795929 ) and 5 down-regulated genes ( LOC100805378, LOC102663255, LOC100306125, LOC100787705, LOC100819491 ). qRT-PCR was conducted using Bio-Rad CFX96 PCR System (USA, Bio-Rad) with a 20 L reaction mixture. The mixture consisted of 10 L HieffTM qPCR SYBR Green Master Mix...”

PTR4_ARATH / Q9FNL8 Protein NRT1/ PTR FAMILY 5.3; AtNPF5.3; Peptide transporter PTR3-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G46040 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
25% identity, 91% coverage

• function: Peptide transporter.
• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...x x Nitrate (NPF family) NPF4.1/AIT3 At3g25260 x x x 2.3 Nitrate (NPF family) NPF5.3/NRT1.8 At5g46040 x 4.1 x x Nitrate (NPF family) NPF5.6 At2g37900 x x 3.57 x Nitrate (NPF family) NPF5.12 At1g72140 2.03 x x x Nitrate (NPF family) NPF5.14/NRT1.15 At1g72120 x 1.83 x...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...At5g46050 NPF51 ABA/GA 1/3/4 [ 9 ]; di-peptides [ 60 ] SA; MeJA; ABA AtNPF5.3 At5g46040 NPF51 ABA [ 18 ] AtNPF5.5 At2g38100 NPF52 NO 3 [ 61 ] AtNPF5.6 At2g37900 NPF51 GA 1/4 [ 18 ] AtNPF5.7 At3g53960 NPF51 ABA/GA 1/3/4 /MeJA [ 18 ]...”
• Characterization of a new high copy Stowaway family MITE, BRAMI-1 in Brassica genome
  Sampath, BMC plant biology 2013
  • “...Bra027073 Bra028379 - 604 A09 16501688 16501868 At5g46350 Bra025021 Bra022033 Bra017561 605 A09 16667316 16667053 At5g46040 - Bra022016 Bra017582 606 A09 16682960 16683223 At5g46040 - Bra022016 Bra017582 608 A09 19871591 19871427 At1g32780 Bra023290 Bra010185 - 615 A09 24192808 24192545 At1g23380 Bra024593 - Bra016348 666 A10 8067999...”
• The association among gene expression responses to nine abiotic stress treatments in Arabidopsis thaliana
  Swindell, Genetics 2006
  • “...At5g44130 At3g59340 At4g18510 At5g39670 At3g14620 At2g30750 At5g46040 At1g06830 At1g72900 At1g02930 At1g74590 At2g43000 At2g26690 At4g28150 At5g01220 (D)a (D)b...”

PTR3_ARATH / Q9FNL7 Protein NRT1/ PTR FAMILY 5.2; AtNPF5.2; Peptide transporter PTR3-A; AtPTR3 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
TC 2.A.17.3.4 / Q9FNL7 Peptide transporter, PTR3-A (induced by histidine, leucine and phenylalanine in cotyledons and lower leaves; involved in stress tolerance in seeds during germination and in defense against virulent bacterial pathogens) from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
PTR3-A / RF|NP_199417.1 peptide transporter PTR3-A from Arabidopsis thaliana (see paper)
NP_199417 peptide transporter 3 from Arabidopsis thaliana
AT5G46050 PTR3 (PEPTIDE TRANSPORTER 3); dipeptide transporter/ transporter/ tripeptide transporter from Arabidopsis thaliana
24% identity, 89% coverage

• function: Peptide transporter involved in stress tolerance in seeds during germination and in defense against virulent bacterial pathogens.
• substrates: peptides
• AtPTR3, a wound-induced peptide transporter needed for defence against virulent bacterial pathogens in Arabidopsis.
  Karim, Planta 2007 (PubMed)
  • GeneRIF: The function and expression regulation of PTR3 are reported.
• Structural and functional characterization of AtPTR3, a stress-induced peptide transporter of Arabidopsis.
  Karim, Journal of molecular modeling 2005 (PubMed)
  • GeneRIF: a strong induction of the AtPTR3 gene was obtained in the whole plant upon exposure to salt; results suggest that the AtPTR3 protein is involved in stress tolerance in seeds during germination.
• Genomic Variation Landscape of the Model Salt Cress Eutrema salsugineum
  Wang, Frontiers in plant science 2021
  • “...GO: 0009628 Response to salt stress 0.00014 Thhalv10023595m AT1G62380 1-aminocyclopropane-1-carboxylate oxidase 2 (ACO2) peptide Thhalv10000830m AT5G46050 Transporter 3 (PTR3) Thhalv10001865m AT3G09260 Glycosyl hydrolase superfamily protein (PYK10) Thhalv10003061m AT4G12720 MutT/nudix family protein (NUDT7) Thhalv10013480m AT5G03630 Pyridine nucleotide-disulfide oxidoreductase family protein (MDAR2) III Thhalv10021496m AT3G23180 HR-like lesion-inducing protein-like...”
• The Arabidopsis RLCK VI_A2 Kinase Controls Seedling and Plant Growth in Parallel with Gibberellin
  Valkai, International journal of molecular sciences 2020
  • “...1.60 0.001941 yes AT3G16180 AT3G16180 Major facilitator superfamily protein, NPF 1.1 a 1.79 0.001941 yes AT5G46050 PTR3 peptide transporter 3, NPF 5.2 a 0.55 0.001941 yes AT5G62680 GTR2 Major facilitator superfamily protein, NPF 2.11 c 0.65 0.031474 yes DEGs of DELLA Transcription Regulators *** AT1G14920 GAI...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...18 , 58 ] AtNPF5.1 At2g40460 NPF51 ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF5.2 PTR3 At5g46050 NPF51 ABA/GA 1/3/4 [ 9 ]; di-peptides [ 60 ] SA; MeJA; ABA AtNPF5.3 At5g46040 NPF51 ABA [ 18 ] AtNPF5.5 At2g38100 NPF52 NO 3 [ 61 ] AtNPF5.6 At2g37900...”
• Transcriptome analysis reveals key roles of AtLBR-2 in LPS-induced defense responses in plants
  Iizasa, BMC genomics 2017
  • “...[ 55 ] AT4G12480 Early Arabidopsis aluminum induced 1 (pEARLI 1)* 2.334243 [ 56 ] AT5G46050 Peptide transporter 3 (PTR3)* 2.322650 [ 57 ] AT3G28580 P-loop containing nucleoside triphosphate hydrolases superfamily protein 2.314015 AT3G50480 Homolog of RPW8 4 (HR4)* 2.311148 [ 10 ] AT2G26400 Acireductone dioxygenase...”
• Biology in the Dry Seed: Transcriptome Changes Associated with Dry Seed Dormancy and Dormancy Loss in the Arabidopsis GA-Insensitive sleepy1-2 Mutant
  Nelson, Frontiers in plant science 2017
  • “...LTP4 4.40 At4g02380 LEA5 2.34 At1g21630 EF hand family 1.65 2.77 2.95 At1g44575 NPQ4 0.89 At5g46050 PTR3 1.26 At5g54070 HSFA9 1.34 At4g09610 GASA2 1.29 At3g45970 EXPL1 1.01 At2g34740 A PP2C 0.97 At3g22490 A LEA 0.91 At5g45690 Unknown protein 0.83 At2g46240 BAG6 -2.13 -2.69 -3.19 At2g46250 Myosin...”
• Decreased glutathione reductase2 leads to early leaf senescence in Arabidopsis
  Ding, Journal of integrative plant biology 2016
  • “...7.340.9 AT3G26830 Phytoalexin deficient (PAD3) 2.25 5.661.4 AT4G12470 Azelaic acid induced 1 (AZI1) 2.62 7.651.1 AT5G46050 Peptide transporter PTR3A (PTR3) 2.27 8.051.5 AT5G64930 Regulator of pathogenesisrelated (HYS1) 2.66 6.001.7 AT3G57240 Beta1,3glucanase 3 (BG3) 4.58 7.921.2 Phytohormone pathway AT4G11890 Protein kinase family protein (ARCK1) 2.07 4.660.4 AT2G13810...”
• Comparative Leaf and Root Transcriptomic Analysis of two Rice Japonica Cultivars Reveals Major Differences in the Root Early Response to Osmotic Stress
  Baldoni, Rice (New York, N.Y.) 2016
  • “...not yet well defined (Saier et al. 2006 ). This gene is similar to AtPTR3 (AT5G46050), whose expression is induced by salt stress and mechanical wounding and is regulated by jasmonic acid and salicylic acid (Karim et al. 2005 ; Karim et al. 2007 ). Another...”
• Transcriptomic profiling of linolenic acid-responsive genes in ROS signaling from RNA-seq data in Arabidopsis
  Mata-Pérez, Frontiers in plant science 2015
  • “...associated with drought stress responses (Cheng et al., 2012 ), while peptide transporter 3 ( AT5G46050 ), involved in the response to wounding, was also repressed. Finally, another important group of down-regulated genes was activated in the response to cold and osmotic stress (16.36 and 8.73%,...”
  • “...XTH31 (AT3G44990), Arabidopsis thaliana xyloglucan endotransglycosylase/hydrolase 31; CHX17 (AT4G23700), Arabidopsis thaliana cation/H(+) antiporter 17; PTR3 (AT5G46050), Arabidopsis thaliana putative peptide transporter protein 3; CLV3 (AT2G27250), Arabidopsis thaliana protein CLAVATA 3; OZF1 (AT2G19810), Arabidopsis thaliana Oxidation-related Zinc Finger protein 1; HAC5 (AT3G12980), Arabidopsis thaliana histone acetyltransferase 5;...”
• More

LOC106397267 protein NRT1/ PTR FAMILY 2.10-like from Brassica napus
26% identity, 83% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...database against the rapeseed reference genome cv. ZS11 (Bra_napus_v2.0) and six paralogs of BnGTR1 ( LOC106397267, LOC106408997, LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length...”
  • “...genes Locus number Genomic sequence length (bp) Number of exons Coding region (bp) AtGTR1 BnGTR1 LOC106397267 2798 4 1905 BnGTR1 LOC106408997 2673 4 1848 BnGTR1 LOC106410496 2649 4 1848 BnGTR1 LOC106414122 2666 4 1848 BnGTR1 LOC106445255 2988 4 1905 BnGTR1 LOC111202315 2685 4 1848 AtGTR2 BnGTR2...”

LOC106445255 protein NRT1/ PTR FAMILY 2.10 from Brassica napus
25% identity, 83% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...reference genome cv. ZS11 (Bra_napus_v2.0) and six paralogs of BnGTR1 ( LOC106397267, LOC106408997, LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames of...”
  • “...LOC106408997 2673 4 1848 BnGTR1 LOC106410496 2649 4 1848 BnGTR1 LOC106414122 2666 4 1848 BnGTR1 LOC106445255 2988 4 1905 BnGTR1 LOC111202315 2685 4 1848 AtGTR2 BnGTR2 LOC106347844 2842 4 1839 BnGTR2 LOC106366161 2755 4 1839 BnGTR2 LOC106369007 8538 4 1839 BnGTR2 LOC106405453 2453 4 1839 BnGTR2...”

LOC106369007 protein NRT1/ PTR FAMILY 2.11 from Brassica napus
25% identity, 87% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...LOC106408997, LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames of six BnGTR1 and six BnGTR2 paralogs were amplified from genomic DNA and...”
  • “...2685 4 1848 AtGTR2 BnGTR2 LOC106347844 2842 4 1839 BnGTR2 LOC106366161 2755 4 1839 BnGTR2 LOC106369007 8538 4 1839 BnGTR2 LOC106405453 2453 4 1839 BnGTR2 LOC106411192 2868 4 1836 BnGTR2 LOC106424883 2754 4 1839 Table 9 CRISPR target sequences (sgRNAs). Name Sequence (5 -3 ) Target...”

PTR53_ARATH / Q9LV10 Protein NRT1/ PTR FAMILY 2.11; AtNPF2.11; Nitrate transporter 1.10; Protein GLUCOSINOLATE TRANSPORTER-2 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
TC 2.A.17.3.20 / Q9LV10 High-affinity, proton-dependent glucosinolate-specific transporter-2, GTP2 or NPF2.11. Involved in apoplasmic phloem-loading of glucosinolates and in bidirectional long-distance transport of aliphatic but not indole glucosinolates. May be involved in removal of glucosinolates from the xylem in roots from Arabidopsis thaliana
NP_201074 Major facilitator superfamily protein from Arabidopsis thaliana
AT5G62680 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
25% identity, 86% coverage

• function: High-affinity, proton-dependent glucosinolate-specific transporter. Involved in apoplasmic phloem-loading of glucosinolates and in bidirectional long-distance transport of aliphatic but not indole glucosinolates. May be involved in removal of glucosinolates from the xylem in roots.
  disruption phenotype: 48% reduction in total glucosinolate levels in seeds. Gtr1 and gtr2 double mutant has no detectable glucosinolate in seeds.
• substrates: Glucosinolates
• Rhizosecretion of stele-synthesized glucosinolates and their catabolites requires GTR-mediated import in Arabidopsis.
  Xu, Journal of experimental botany 2017
  • GeneRIF: Expression of glucosinolate (GLS) importers GTR1 and GTR2 inside the stele, along with earlier observations, suggest three possible routes of stele-synthesized aliphatic GLS after their synthesis: (i) GTR-dependent import to cells symplastically connected to cortical cells and rhizosphere; (ii) GTR-independent transport via xylem to the shoot; and (iii) GTR-dependent import to GLS-degrading myrosin cells at the cortex.
• A Functional EXXEK Motif is Essential for Proton Coupling and Active Glucosinolate Transport by NPF2.11.
  Jørgensen, Plant & cell physiology 2015
  • GeneRIF: Study demonstrates an essential role for E1X1X2E2K motif for accumulation of substrate by NPF2.11. [NPF2.11]
• Upon bolting the GTR1 and GTR2 transporters mediate transport of glucosinolates to the inflorescence rather than roots.
  Andersen, Plant signaling & behavior 2014
  • GeneRIF: glucosinolate can specifically translocate from rosette and roots to inflorescence in a GTR1- and GTR2-dependent manner
• Elucidating the role of transport processes in leaf glucosinolate distribution.
  Madsen, Plant physiology 2014
  • GeneRIF: GTR2 role of transport processes in leaf glucosinolate distribution
• NRT/PTR transporters are essential for translocation of glucosinolate defence compounds to seeds.
  Nour-Eldin, Nature 2012 (PubMed)
  • GeneRIF: GTR1 and GTR2 control the loading of glucosinolates from the apoplasm into the phloem. [GTR2]
• Comparative Proteomic and Metabonomic Profiling of Buds with Different Flowering Capabilities Reveal Novel Regulatory Mechanisms of Flowering in Apple
  Wang, Plants (Basel, Switzerland) 2023
  • “...MD08G1186700 DHAPS-1 Phospho-2-dehydro-3-deoxyheptonate aldolase 1 53 24.1 3 59.6 8.34 0.9 0.81 1.11 43 MD06G1186500 At5g62680 Probable peptide/nitrate transporter 9.1 6.5 2 48 8.84 0.77 * 0.84 0.91 44 MD05G1102900 SCPL18 Serine carboxypeptidase-like 18 27.2 18.2 4 51.8 5.38 0.89 0.73 * 1.22 45 MD07G1207000 SCPL50...”
• Genome- and transcriptome-wide association studies reveal the genetic basis and the breeding history of seed glucosinolate content in Brassica napus
  Tan, Plant biotechnology journal 2022
  • “...biosynthetic process (Figure 1e ; Dataset S8 ). Genes encoding transporters, such as GTR2 ( AT5G62680 ) and BAT5 ( AT4G12030 ), transcription factors including HAG1/MYB28 ( AT5G61420 ) and MYC3 ( AT5G46760 ), as well as cytochrome P450 family members, CYP83A1 ( AT4G13770 ) and...”
• A population based expression atlas provides insights into disease resistance and other physiological traits in cassava (Manihot esculenta Crantz)
  Ogbonna, Scientific reports 2021
  • “...AT5G46240 Potassium channel KAT1 Ion channel 26 Manes.06G123400.v6.1 AT5G50790 Bidirectional sugar transporter SWEET10 27 Manes.14G074000.v6.1 AT5G62680 Protein NRT1/ PTR FAMILY 2.11 transporter Genetic variance explained by SNP markers in the detected 8,820 DEG regions Evaluating the functional relevance of the detected DEGs, proportion of variance explained...”
• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...Construction Two known BnGTR orthologs from A. thaliana, AtGTR1 ( AT3G47960 ) and AtGTR2 ( AT5G62680 ) were used for a BLAST query in the NCBI database against the rapeseed reference genome cv. ZS11 (Bra_napus_v2.0) and six paralogs of BnGTR1 ( LOC106397267, LOC106408997, LOC106410496, LOC106414122, LOC106445255...”
• A cell suspension based uptake method to study high affinity glucosinolate transporters
  Nambiar, Plant methods 2020
  • “...Sequence (5-3) Gene amplification 1 At3G47960 GTR1 FP CACCATGAAGAGCAGAGTCATTCTTAACC 2 At3G47960 GTR1 RP TCAGACAGAGTTCTTGTCTTGTAGC 3 At5G62680 GTR2 FP CACCATGGAGAGAAAGCCTCTTGAAC 4 At5G62680 GTR2 RP TCAGGCAACGTTCTTGTCTTGCTG Transgene insertion validation 5 Bar FP GCTCTACACCCACCTGCTGAA-3 6 Bar RP TCAGATCTCGGTGACGG-3 7 GTR1 internal FP ATCAACAGTTTCTTCAACTGGT 8 GTR2 internal FP TGGGGCTGATCAGTTTAACC 9...”
• The Arabidopsis RLCK VI_A2 Kinase Controls Seedling and Plant Growth in Parallel with Gibberellin
  Valkai, International journal of molecular sciences 2020
  • “...a 1.79 0.001941 yes AT5G46050 PTR3 peptide transporter 3, NPF 5.2 a 0.55 0.001941 yes AT5G62680 GTR2 Major facilitator superfamily protein, NPF 2.11 c 0.65 0.031474 yes DEGs of DELLA Transcription Regulators *** AT1G14920 GAI GRAS family transcription factor family protein 1.46 0.00859 yes AT2G01570 RGL1...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...8MTO [ 47 ]; GA 1/3/4 /MeJA [ 18 , 54 ] MeJA AtNPF2.11 NRT1.10/GTR2 At5g62680 NPF21 NO 3 /4MTB [ 20 ]; 8MTO [ 47 ]; GA 3 [ 55 ] AtNPF2.12 NRT1.6 At1g27080 NPF21 NO 3 [ 56 ]; GA 1/3 [ 18 ]...”
• Association Mapping of Seed Quality Traits Under Varying Conditions of Nitrogen Application in Brassica juncea L. Czern & Coss
  Akhatar, Frontiers in genetics 2020
  • “...protein A06, A09 AT3G47340 GLUTAMINE-DEPENDENT ASPARAGINE SYNTHETASE A02, A06 A6 AT3G54010 PASTICCINO-1 A04, A07 A4 AT5G62680 GTR2 A02, A03, A06, A09 A1, A2, A6, A9 GSL AT1G19640 S -adenosyl- L -methionine-dependent methyltransferases superfamily protein A06, A07, A08 A6, A7 AT2G21940 SK1 (AT2G21940) A04 A6 AT2G35450 AT2G35450...”
• More

LOC106405453 protein NRT1/ PTR FAMILY 2.11 from Brassica napus
25% identity, 87% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames of six BnGTR1 and six BnGTR2 paralogs were amplified from genomic DNA and cDNA...”
  • “...LOC106347844 2842 4 1839 BnGTR2 LOC106366161 2755 4 1839 BnGTR2 LOC106369007 8538 4 1839 BnGTR2 LOC106405453 2453 4 1839 BnGTR2 LOC106411192 2868 4 1836 BnGTR2 LOC106424883 2754 4 1839 Table 9 CRISPR target sequences (sgRNAs). Name Sequence (5 -3 ) Target gene sgRNA1 AATGAGACATTTGAGAAGAT BnGTR1 sgRNA2...”

PTR45_ARATH / Q9M331 Protein NRT1/ PTR FAMILY 5.7; AtNPF5.7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G53960 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
25% identity, 90% coverage

• Reported differences in the flg22 response of the null mutation of AtRGS1 correlates with fixed genetic variation in the background of Col-0 isolates
  Ghusinga, Plant signaling & behavior 2021 (secret)
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...NPF52 NO 3 [ 61 ] AtNPF5.6 At2g37900 NPF51 GA 1/4 [ 18 ] AtNPF5.7 At3g53960 NPF51 ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF5.10 At1g22540 NPF51 NO 3 [ 61 ] AtNPF6.2 NRT1.4 At2g26690 NPF61 NO 3 [ 62 ] AtNPF6.3 NRT1.1/CHL1 At1g12110 NPF61 NO 3...”
• Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3
  Abdeen, BMC genomics 2010
  • “...family protein/ERD1/XPR1/SYG1 family protein 1.103 250151_at At5g14570 High affinity nitrate transporter 2.7 (AtNRT2.7) -1.317 251916_at At3g53960 Proton-dependent oligopeptide transport (POT) family protein 1.278 1.548 252589_s_at At3g45650/At3g45660 Proton-dependent oligopeptide transport (POT) family protein 1.164 0.740 254396_at At4g21680 Proton-dependent oligopeptide transport (POT) family protein 2.426 Values are log2...”
  • “...(WRKY40) 2 3.762 4.724 5.138 Transporters 260543_at At2g43330 Inositol transporter 1 (AtINT1) 1 1.118 251916_at At3g53960 Proton-dependent oligopeptide transport (POT) family protein 2 1.278 1.548 Other 251904_at At3g54130 Josephin family protein 1 1.043 1.311 265634_at At2g25530 AFG1-like ATPase family protein 2 1.399 252557_at At3g45960 Expansin family...”
• Chromatin and siRNA pathways cooperate to maintain DNA methylation of small transposable elements in Arabidopsis
  Tran, Genome biology 2005
  • “...At2g20020 Expressed protein - - 2:11049695-11050396 At2g25900 Zinc finger (CCCH-type) family protein - - 3:19989359-19990040 At3g53960 Proton-dependent oligopeptide transport - 2:5627581-5628302 non-LTR retrotransposon family (LINE) - 1:8273192-8273908 At1g23320 Alliinase family protein contains Pfam - 1:22107946-22108642 At1g60020 Copia-like retrotransposon family - 2:7532595-7533279 At2g17305 Hypothetical protein - 2:13188318-13189035...”

LOC115716024 protein NRT1/ PTR FAMILY 7.3 from Cannabis sativa
26% identity, 89% coverage

• Sink strength, nutrient allocation, cannabinoid yield, and associated transcript profiles vary in two drug-type Cannabis chemovars
  Jost, Journal of experimental botany 2025
  • “...the plant ( Fig. 9A ; Supplementary Table S7 ). Out of 18 genes, three (LOC115716024, LOC115709842, LOC115700848) showed higher expression in the stems of the THC- over the CBD-dominant chemovar suggesting a role in long-distance nitrate transport. Our sequence analysis indicated that LOC115709842 is a...”

LOC100258695 protein NRT1/ PTR FAMILY 2.11 from Vitis vinifera
25% identity, 93% coverage

• Coastal Wild Grapevine Accession (Vitis vinifera L. ssp. sylvestris) Shows Distinct Late and Early Transcriptome Changes under Salt Stress in Comparison to Commercial Rootstock Richter 110
  Carrasco, Plants (Basel, Switzerland) 2022
  • “...(50 mM-0 d vs. 85 mM-7 d) 4.4.1. Ion Transport AS1B showed two NRT/PTR DEGs (LOC100258695 and LOC100259122) ( Figure 6 and Supplementary Data S4 ). Relative expression of LOC100258695 remains higher in Richter 110 than in AS1B across all treatments ( Supplementary Figure S1 ),...”
  • “...d. Supplementary Data S6: Primers designed for the RT-qPCR. Supplementary Figure S1: Relative expression of LOC100258695 in Richter 110 and AS1B genotypes. Supplementary Figure S2: Relative expression of LOC100259122 in Richter 110 and AS1B genotypes. Supplementary Figure S3: Relative expression of LOC100264818 in Richter 110 and...”

LOC104740346 protein NRT1/ PTR FAMILY 2.11 from Camelina sativa
25% identity, 87% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...included in this study: CsGTR1A, B, C, LOC104711273, LOC104791006, LOC104780607; CsGTR2A, B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors declare no conflict of interest. Author contributions...”

LOC115700848 protein NRT1/ PTR FAMILY 6.4 from Cannabis sativa
25% identity, 90% coverage

• Sink strength, nutrient allocation, cannabinoid yield, and associated transcript profiles vary in two drug-type Cannabis chemovars
  Jost, Journal of experimental botany 2025
  • “...( Fig. 9A ; Supplementary Table S7 ). Out of 18 genes, three (LOC115716024, LOC115709842, LOC115700848) showed higher expression in the stems of the THC- over the CBD-dominant chemovar suggesting a role in long-distance nitrate transport. Our sequence analysis indicated that LOC115709842 is a homologue of...”

LOC100263051 protein NRT1/ PTR FAMILY 5.2 from Vitis vinifera
23% identity, 92% coverage

• Transcriptome analysis revealed the expression levels of genes related to abscisic acid and auxin biosynthesis in grapevine (Vitis vinifera L.) under root restriction
  Wang, Frontiers in plant science 2022
  • “...DNA-templated| response to abscisic acid| response to salt stress| transcription, DNA-templated| viral process| xylem development LOC100263051 NPF8.1 protein NRT1/PTR FAMILY 5.2 Down GO:0016021,GO:0042936, GO:0042937,GO:0042742, GO:0042938,GO:0042538, GO:0009737,GO:0080052, GO:0009753,GO:0043201, GO:0080053,GO:0009751, GO:0009611,GO:0042939 integral component of membrane| dipeptide transporter activity| tripeptide transporter activity| defense response to bacterium| dipeptide transport| hyperosmotic...”

LOC105168762 protein NRT1/ PTR FAMILY 2.10-like from Sesamum indicum
24% identity, 91% coverage

• Transcriptome Analysis of Sesame (Sesamum indicum L.) Reveals the LncRNA and mRNA Regulatory Network Responding to Low Nitrogen Stress
  Zhang, International journal of molecular sciences 2024
  • “...and S6 ). Among them, DELs MSTRG.17494.1 targets three plant NRT1/PTR family members NPF2.11(LOC105168760), NPF2.10 (LOC105168762) and NPF4.6 (LOC105168767), a previously study has proved that the NRT/NPF protein play vital roles in moving substrates including amino acids, peptides, nitrate, dicarboxylates, glucosinolates, ABA, IAA, JA and so...”

PTR51_ARATH / Q3E9B5 Protein NRT1/ PTR FAMILY 7.1; AtNPF7.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G19640 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
24% identity, 89% coverage

• A Functional EXXEK Motif is Essential for Proton Coupling and Active Glucosinolate Transport by NPF2.11
  Jørgensen, Plant & cell physiology 2015
  • “...et al. 2014 ). These belong to the NAXT and NRT1.5 subclades (At1g32450, At4g21680 and At5g19640), which appear to encode nitrate transporters ( Segonzac et al. 2007 , Lin et al. 2008 , Li et al. 2010 ). Among the NPF transporters and POT/PTR homologs encoding...”
• Dichotomy in the NRT gene families of dicots and grass species
  Plett, PloS one 2010
  • “...we found that the grass 1.5B clade had a nearer phylogenetic neighbour (a PTR gene At5g19640) even though BLAST result scores were higher for 1.5 and 1.8. Since both clades sit equidistant from AtNRT1.5 (and neither more closely related to AtNRT1.8 ) an unambiguous assignment of...”

XP_008658424 protein NRT1/ PTR FAMILY 6.3 from Zea mays
25% identity, 89% coverage

• Maize NPF6 Proteins Are Homologs of Arabidopsis CHL1 That Are Selective for Both Nitrate and Chloride.
  Wen, The Plant cell 2017
  • GeneRIF: The protein is localized to the plasma membrane. The gene is induced by nitrate in roots. Xenopus oocytes injected with cDNA exhibit: pH-dependent, inward, high affinity, nitrate flux; pH-dependent, inward low affinity chloride flux; nitrate-selective transport. In vitro site-mutagenesis shows that T104 is involved in high affinity nitrate transport.

LOC107867437 protein NRT1/ PTR FAMILY 6.3 from Capsicum annuum
26% identity, 90% coverage

• Transcriptomic Analysis Reveals the Response Mechanisms of Bell Pepper (Capsicum annuum) to Phosphorus Deficiency
  Salazar-Gutiérrez, Metabolites 2023
  • “...0.0387 LOC107875359 peptidyl-prolyl cis-trans isomerase FKBP62 1.86888069 0.0038 LOC107850219 two-component response regulator-like PRR37 1.8876322 0.0006 LOC107867437 protein NRT1/PTR FAMILY 6.3 1.90637911 0.0416 LOC107867141 flavonoid 3-monooxygenase CYP75B137-like 1.90863477 0.0077 LOC107844409 putative MO25-like protein At5g47540 1.95369314 0.0001 LOC107840006 actin-100 1.96013972 0.0179 LOC107839836 chloride channel protein CLC-c 1.96864421 0.0059...”

LOC106411192 protein NRT1/ PTR FAMILY 2.11 from Brassica napus
25% identity, 88% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames of six BnGTR1 and six BnGTR2 paralogs were amplified from genomic DNA and cDNA of...”
  • “...LOC106366161 2755 4 1839 BnGTR2 LOC106369007 8538 4 1839 BnGTR2 LOC106405453 2453 4 1839 BnGTR2 LOC106411192 2868 4 1836 BnGTR2 LOC106424883 2754 4 1839 Table 9 CRISPR target sequences (sgRNAs). Name Sequence (5 -3 ) Target gene sgRNA1 AATGAGACATTTGAGAAGAT BnGTR1 sgRNA2 GAATCAACAGTTTCTTCAAC BnGTR1 sgRNA3 TTTGAGAAGCTTGGGATCAT BnGTR2...”

LOC104726867 protein NRT1/ PTR FAMILY 2.11 from Camelina sativa
25% identity, 87% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...were included in this study: CsGTR1A, B, C, LOC104711273, LOC104791006, LOC104780607; CsGTR2A, B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors declare no conflict of interest. Author...”

LOC104762400 protein NRT1/ PTR FAMILY 2.11 from Camelina sativa
25% identity, 87% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...sequences were included in this study: CsGTR1A, B, C, LOC104711273, LOC104791006, LOC104780607; CsGTR2A, B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors declare no conflict of interest....”

LOC106347844 protein NRT1/ PTR FAMILY 2.11 from Brassica napus
25% identity, 87% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...( LOC106397267, LOC106408997, LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames of six BnGTR1 and six BnGTR2 paralogs were amplified from genomic...”
  • “...2666 4 1848 BnGTR1 LOC106445255 2988 4 1905 BnGTR1 LOC111202315 2685 4 1848 AtGTR2 BnGTR2 LOC106347844 2842 4 1839 BnGTR2 LOC106366161 2755 4 1839 BnGTR2 LOC106369007 8538 4 1839 BnGTR2 LOC106405453 2453 4 1839 BnGTR2 LOC106411192 2868 4 1836 BnGTR2 LOC106424883 2754 4 1839 Table 9...”

LOC106424883 protein NRT1/ PTR FAMILY 2.11-like from Brassica napus
25% identity, 87% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames of six BnGTR1 and six BnGTR2 paralogs were amplified from genomic DNA and cDNA of cv. Kumily,...”
  • “...LOC106369007 8538 4 1839 BnGTR2 LOC106405453 2453 4 1839 BnGTR2 LOC106411192 2868 4 1836 BnGTR2 LOC106424883 2754 4 1839 Table 9 CRISPR target sequences (sgRNAs). Name Sequence (5 -3 ) Target gene sgRNA1 AATGAGACATTTGAGAAGAT BnGTR1 sgRNA2 GAATCAACAGTTTCTTCAAC BnGTR1 sgRNA3 TTTGAGAAGCTTGGGATCAT BnGTR2 sgRNA4 TTCCTTTGCGACACTTACTT BnGTR2 Protoplast Transfection...”

LOC106410496 protein NRT1/ PTR FAMILY 2.10-like from Brassica napus
24% identity, 86% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...the rapeseed reference genome cv. ZS11 (Bra_napus_v2.0) and six paralogs of BnGTR1 ( LOC106397267, LOC106408997, LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading...”
  • “...Coding region (bp) AtGTR1 BnGTR1 LOC106397267 2798 4 1905 BnGTR1 LOC106408997 2673 4 1848 BnGTR1 LOC106410496 2649 4 1848 BnGTR1 LOC106414122 2666 4 1848 BnGTR1 LOC106445255 2988 4 1905 BnGTR1 LOC111202315 2685 4 1848 AtGTR2 BnGTR2 LOC106347844 2842 4 1839 BnGTR2 LOC106366161 2755 4 1839 BnGTR2...”

LOC104740588 protein NRT1/ PTR FAMILY 2.9 from Camelina sativa
23% identity, 92% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...CsGTR2A, B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors declare no conflict of interest. Author contributions G.H. and P.D. designed the experiments and wrote the manuscript....”

TC 2.A.17.3.21 / Q9SPU1 Low affinity nitrate transporter, Nrt1, of 584 aas and 13 putative TMSs from Oryza sativa
25% identity, 92% coverage

• substrates: nitrate
  tcdb comment: Two splice variants, Ntr1.1a and Ntr1.1b, have been identified. Under low nitrogen condition, Nrt1.1b accumulates more nitrogen in plants and improves rice growth, but Ntr1.1a had no such effect (Fan et al. 2015)

LOC101497328 protein NRT1/ PTR FAMILY 5.6-like from Cicer arietinum
22% identity, 91% coverage

• Morphophysiological and transcriptome analysis reveal that reprogramming of metabolism, phytohormones and root development pathways governs the potassium (K⁺) deficiency response in two contrasting chickpea cultivars
  Ankit, Frontiers in plant science 2022
  • “...high affinity nitrate transporter 2.4 -2.6 Down LOC101506906 high affinity nitrate transporter 2.5 -1.2 Down LOC101497328 protein NRT1/PTR FAMILY 5.6-like -1.2 Down LOC101497004 protein NRT1/PTR FAMILY 2.6 -1.1 Down LOC101495372 S-type anion channel SLAH1 -1.5 Down PUSA372 LOC101503875 high affinity nitrate transporter 2.4 1.9 Up LOC101497071...”
• Comparative Root Transcriptomics Provide Insights into Drought Adaptation Strategies in Chickpea (Cicer arietinum L.)
  Bhaskarla, International journal of molecular sciences 2020
  • “...nitrate transporters NRT1 / PTR FAMILY 3.1 (LOC101498251) and NRT1 / PTR FAMILY 5.6 -like (LOC101497328) were strongly upregulated in both the genotypes at RS ( Figure 6 ). Water molecules are transported passively by aquaporin channel proteins in the cell. We found that aquaporin genes...”

PTR25_ARATH / Q9C7U1 Protein NRT1/ PTR FAMILY 5.12; AtNPF5.12 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT1G72140 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
NP_177359 Major facilitator superfamily protein from Arabidopsis thaliana
24% identity, 91% coverage

• PIN2-mediated self-organizing transient auxin flow contributes to auxin maxima at the tip of Arabidopsis cotyledons
  Pérez-Henríquez, Nature communications 2025
  • “...silicoanalysis The sequence spanning from +1346bp until transcription start site (TSS) of the TOB1 gene (AT1G72140) was analyzed using promoter analysis tool PlantRegMap. Additionally, the sequence extending +1000bp upstream the TSS was examined using PSCAN, http://159.149.160.88/pscan , a widely used promoter analysis tool. The PINs and...”
• Nitrate transporter protein NPF5.12 and major latex-like protein MLP6 are important defense factors against Verticillium longisporum
  Dölfors, Journal of experimental botany 2024
  • “...). When analysing the transcript levels of these potential candidates, the nitrate peptide transporter AtNPF5.12 (At1g72140) was non-responsive in Sei-0 at 2 dpi and down-regulated in Can-0 ( Fig. 1C ), indicating that this gene might contribute to the differential V. longisporum response observed in the...”
  • “...the 1001 Genomes database revealed a short indel (9 nt) in the promoter sequence of At1g72140 in Sei-0 at position Chr1:27141089. We believe this is the main reason why Sei-0 exhibits a resistant phenotype compared with Col-0 and Can-0. Furthermore, Col-0 harbors an SNP in exon...”
• Transcriptomic analysis reveals the functions of H₂S as a gasotransmitter independently of Cys in Arabidopsis
  Fang, Frontiers in plant science 2023
  • “...treatment AT1G09070 , AT1G19180 , AT1G22190 , AT1G25400 , AT1G25560 , AT1G32920 , AT1G66180 , AT1G72140 , AT1G73500 , AT1G76650 , AT2G27080 , AT2G27830 , AT3G20370 , AT3G49570 , AT3G50800 , AT4G23870 , AT4G32480 , AT4G37260 , AT5G07580 , AT5G14730 , AT5G24660 , AT5G26220 , AT5G26260...”
• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...x x Nitrate (NPF family) NPF5.6 At2g37900 x x 3.57 x Nitrate (NPF family) NPF5.12 At1g72140 2.03 x x x Nitrate (NPF family) NPF5.14/NRT1.15 At1g72120 x 1.83 x x Nitrate (NPF family) NPF6.2/NRT1.4 At2g26690 x x 2.11 1.61 Ammonium (AMT family) AMT13 At3g24300 x 2.42 x...”
• Molecular Targets and Biological Functions of cAMP Signaling in Arabidopsis
  Xu, Biomolecules 2021
  • “...in plants [ 180 ]. Notably, several nitrate transporters belong to the CRGs, including NPF5.12 (AT1G72140), which mediates nitrate uptake in a pH-dependent manner and acts as vacuolar nitrate efflux transporters [ 181 ], NPF7.2/NRT1.8 (AT4G21680) functioning to remove nitrate from xylem vessels [ 182 ],...”
  • “...Ca 2+ AtCNGC2 (AT5G15410), CAX7 (AT5G17860), CSC1-like proteins (AT1G10090; AT1G62320) K + AtKUP7 Nitrate NPF5.12 (AT1G72140), NPF7.2/NRT1.8 (AT4G21680), NRT2.6 (AT3G45060), NPF2.7/NAXT1(AT3G45650), CLC-b (AT3G27170) Sugar SWEET16 (AT3G16690), HKL1 (AT1G50460), PMT6/PLT6 (AT4G36670) Lipid MIOX2 (AT2G19800), ITPK3 (AT4G08170), SFH14 (AT5G56160) Light BG1 (AT5G12050), ERD7 (AT2G17840), KNAT4 (AT5G11060), DFL2 (AT4G03400),...”
• Recent Findings Unravel Genes and Genetic Factors Underlying Leptosphaeria maculans Resistance in Brassica napus and Its Relatives
  Cantila, International journal of molecular sciences 2020
  • “...BnaA02g15610D RLK AT1G71870 Protein DETOXIFICATION 54/MATE efflux fam_prot [ 70 , 76 ] BnaA02g15810D RLK AT1G72140 Protein NRT1/PTR FAMILY 5.12/proton-dependent oligopeptide transport (POT) fam_prot [ 70 , 76 ] BnaA02g15820D RLK AT1G72150 Patellin-1/transporter [ 70 , 76 ] BnaA02g15890D RLK AT1G72290.1 (CDS) Cysteine protease inhibitor WSCP...”
• TRANSPORTER OF IBA1 Links Auxin and Cytokinin to Influence Root Architecture
  Michniewicz, Developmental cell 2019
  • “...transmembrane domain 8 ( Figures 1E and 1F ). We obtained insertional alleles defective in At1g72140 ( Figure 1D ) and found that these, like our missense allele, displayed mild resistance to the long-chain auxins IBA and 2,4-DB and wild-type sensitivity to the active auxins IAA...”
  • “...in isolate PS173. Because these insertional alleles displayed similar phenotypes as the missense allele in At1g72140 removed from the pen3 - 4 background ( Figure 1G ), we named this gene TRANSPORTER OF IBA1 (TOB1). We named the original missense allele tob1 - 1 and the...”
• Tonoplast-localized nitrate uptake transporters involved in vacuolar nitrate efflux and reallocation in Arabidopsis
  He, Scientific reports 2017
  • “...the Arabidopsis Genome Initiative or GenBank/EMBL databases under the following accession numbers: NPF5.11 (At1g72130), NPF5.12 (At1g72140), NPF5.16 (At1g22550), NRT1.8 (At4g21680), CHL1 (At1g12110), SAND (At2g28390), Actin2 (At3g18780). Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations. Acknowledgements We thank...”
• More
• TRANSPORTER OF IBA1 Links Auxin and Cytokinin to Influence Root Architecture.
  Michniewicz, Developmental cell 2019
  • GeneRIF: TOB1 is a transporter of the auxin precursor IBA. TOB1 localizes to the vacuolar membrane and regulates root system architecture. [TOB1]
• Tonoplast-localized nitrate uptake transporters involved in vacuolar nitrate efflux and reallocation in Arabidopsis.
  He, Scientific reports 2017
  • GeneRIF: At1g72140 (NPF5.12) is involved in the nitrate from vacuoles into cytosol, thus serving as important player to modulate nitrate allocation between roots and shoots.

LOC106414122 protein NRT1/ PTR FAMILY 2.10-like from Brassica napus
25% identity, 93% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...rapeseed reference genome cv. ZS11 (Bra_napus_v2.0) and six paralogs of BnGTR1 ( LOC106397267, LOC106408997, LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames...”
  • “...LOC106397267 2798 4 1905 BnGTR1 LOC106408997 2673 4 1848 BnGTR1 LOC106410496 2649 4 1848 BnGTR1 LOC106414122 2666 4 1848 BnGTR1 LOC106445255 2988 4 1905 BnGTR1 LOC111202315 2685 4 1848 AtGTR2 BnGTR2 LOC106347844 2842 4 1839 BnGTR2 LOC106366161 2755 4 1839 BnGTR2 LOC106369007 8538 4 1839 BnGTR2...”

LOC18032684 protein NRT1/ PTR FAMILY 5.2 from Citrus x clementina
25% identity, 91% coverage

• Comparative transcriptomic analyses of citrus cold-resistant vs. sensitive rootstocks might suggest a relevant role of ABA signaling in triggering cold scion adaption
  Primo-Capella, BMC plant biology 2022
  • “...transporters belonging to the NRT1/ PTR and ABC G families, NRT1 (LOC18047775), NRT2 (LOC18047776), NRT3 (LOC18032684), NRT4 (LOC18031923O), ABCG40 (LOC18035930, LOC18036075), were up-regulated in the 15-day samples, except ABCG22 (LOC18038312), which was clearly down-regulated in the MAC samples and its expression levels remained high in the...”

LOC18047775 protein NRT1/ PTR FAMILY 2.11 from Citrus x clementina
23% identity, 89% coverage

• Comparative transcriptomic analyses of citrus cold-resistant vs. sensitive rootstocks might suggest a relevant role of ABA signaling in triggering cold scion adaption
  Primo-Capella, BMC plant biology 2022
  • “...genes coding for ABA transporters belonging to the NRT1/ PTR and ABC G families, NRT1 (LOC18047775), NRT2 (LOC18047776), NRT3 (LOC18032684), NRT4 (LOC18031923O), ABCG40 (LOC18035930, LOC18036075), were up-regulated in the 15-day samples, except ABCG22 (LOC18038312), which was clearly down-regulated in the MAC samples and its expression levels...”

LOC104791006 protein NRT1/ PTR FAMILY 2.10-like from Camelina sativa
24% identity, 83% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “.... Accession numbers The following sequences were included in this study: CsGTR1A, B, C, LOC104711273, LOC104791006, LOC104780607; CsGTR2A, B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors...”

PTR23_ARATH / Q0WSZ6 Protein NRT1/ PTR FAMILY 5.13; AtNPF5.13; Nitrate transporter 1.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G72125 transporter from Arabidopsis thaliana
26% identity, 93% coverage

• QTL analysis of the developmental response to L-glutamate in Arabidopsis roots and its genotype-by-environment interactions
  Walch-Liu, Journal of experimental botany 2017
  • “...genes belonging to the same family as the NRT1 nitrate transceptor: At1g72120 ( NRT1.15/AtNPF5.14 ), At1g72125 ( NRT1.16/AtNPF5. 13), At1g72130 ( AtNPF5.11 ), At1g72140 ( AtNPF5.12 ). The NPF family in Arabidopsis has 53 members belonging to 8 subfamilies and between them they transport a diverse...”
• Root transcriptome of two contrasting indica rice cultivars uncovers regulators of root development and physiological responses
  Singh, Scientific reports 2016
  • “...acid transporter, putative 98 LOC_Os06g03770.1 2.0081406 AT5G58270 ABC transporter, ATP-binding protein, putative 99 LOC_Os08g41590.1 6.2401733 AT1G72125 Peptide transporter PTR2, putative, expressed 100 LOC_Os01g17214.1 2.0424147 AT3G43790 Major facilitator superfamily antiporter, putative, expressed 101 Hormone signaling related LOC_Os09g27820.1 19.6028 AT1G05010 1-aminocyclopropane-1-carboxylate oxidase protein, putative, expressed 102 LOC_Os02g43840.1 4.617959...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...the AtPTR genes in 24 development stages released the expression profile of 51 genes except At1g72125, At3g45660 and At3g54450 (Additional file 7 ). Obviously, the expression patterns of AtPTR genes fell into the similar groups as OsPTR genes. Some tissue-specific expression AtPTR genes could also be...”

M0ZJ30 Nitrate transporter NRT1.1 from Solanum tuberosum
24% identity, 95% coverage

• Quantitative Proteomics of Potato Leaves Infected with Phytophthora infestans Provides Insights into Coordinated and Altered Protein Expression during Early and Late Disease Stages
  Xiao, International journal of molecular sciences 2019
  • “...down-regulated proteins K7WNX1 Light-inducible tissue-specific ST-LS1 0.83 0.001 C: photosystem II oxygen-evolving complex; P: photosynthesis M0ZJ30 Uncharacterized protein contains Major facilitator domain 0.74 0.002 C: membrane; F: transmembrane transporter activity; P: transmembrane transport M1BNJ1 Uncharacterized protein contains Carotenoid oxygenase binding site. 0.68 0.05 F: oxidoreductase activity,...”

GRMZM2G176253 peptide transporter PTR2 from Zea mays
25% identity, 89% coverage

• Differential Expression of Genes between a Tolerant and a Susceptible Maize Line in Response to a Sugarcane Mosaic Virus Infection
  Rodríguez-Gómez, Viruses 2022
  • “...Zm00001d018107 AC220927.3_FG007 1.3 0.9 1.2 Protein EXORDIUM Zm00001d033786 GRMZM2G155767 1.7 0.8 1.2 histidine kinase4 Zm00001d016982 GRMZM2G176253 1.4 1.2 1.2 Protein NRT1/PTR FAMILY 6.4 Zm00001d025470 GRMZM2G158097 1.2 0.5 1.2 expressed protein Zm00001d010490 GRMZM2G084489 1.3 0.6 1.1 CW-type Zinc Finger Zm00001d002256 GRMZM5G897776 1.5 0.6 1.0 Starch synthase 3...”
• Nitrogen transporter and assimilation genes exhibit developmental stage-selective expression in maize (Zea mays L.) associated with distinct cis-acting promoter motifs
  Liseron-Monfils, Plant signaling & behavior 2013
  • “...(Glycine max nrt1.2) 4 ZmN-52^ AAD38068.1 GRMZM2G076723; GRMZM2G443637 Nitrate reductase (NADH; nr1) 4 ZmN-51 CAD41034.1 GRMZM2G176253 Nitrate transporter 4 ZmN-50 AAG52554.1 GRMZM2G137421 Nitrate transporter (Atntl1) 4 ZmN-49^ AAD38068.1 GRMZM2G076723; GRMZM2G443637 Nitrate reductase (NADH; nr1) 4 ZmN-48^ AAD38068.1 GRMZM2G076723; GRMZM2G443637 Nitrate reductase (NADH; nr1) 4 ZmN-47 AAO00921.1...”

LOC115710913 protein NRT1/ PTR FAMILY 7.3 from Cannabis sativa
25% identity, 89% coverage

• Sink strength, nutrient allocation, cannabinoid yield, and associated transcript profiles vary in two drug-type Cannabis chemovars
  Jost, Journal of experimental botany 2025
  • “...Tsay, 2011 ; Nour-Eldin et al. , 2012 ) ( Figs 3B , 9A ). LOC115710913, a homologue of Arabidopsis AtNPF7.3 / NRT1.5 involved in root to shoot transport of nitrate ( Lin et al. , 2008 ), showed about 7-fold higher expression in roots, but...”
  • “...and/or ancestral Cannabis ( Ren et al. , 2021 ). The two nitrate transporter genes, LOC115710913 and LOC115699876, were putatively selected in drug-type versus hemp-type Cannabis , while the nitrate reductase-encoding gene LOC115713111 had a positive selection signature in drug-type versus basal Cannabis accessions ( Fig....”

PTR7_ARATH / Q05085 Protein NRT1/ PTR FAMILY 6.3; AtNPF6.3; Nitrate transporter 1.1; AtNRT1; Nitrate/chlorate transporter; Protein CHLORINA 1 from Arabidopsis thaliana (Mouse-ear cress) (see 18 papers)
Q05085 ABC-type nitrate transporter (EC 7.3.2.4) from Arabidopsis thaliana (see 2 papers)
TC 2.A.17.3.1 / Q05085 Dual affinity Nitrate/Chlorate symporter, Nrt1.1; CHL1 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
CHL1 / RF|NP_563899.1 nitrate/chlorate transporter from Arabidopsis thaliana (see paper)
NP_563899 nitrate transporter 1.1 from Arabidopsis thaliana
AT1G12110 NRT1.1; nitrate transmembrane transporter/ transporter from Arabidopsis thaliana
26% identity, 89% coverage

• function: Dual affinity nitrate transporter. Involved in proton- dependent nitrate uptake and in the regulation of the nitrate transporter NRT2.1. Acts also as a nitrate sensor that trigger a specific signaling pathway stimulating lateral root growth and seed germination. The uptake activity is not required for sensor function. Displays an auxin transport facilitation inhibited by high nitrate concentration. Required to prevent auxin accumulation in preemerged lateral root primordia and young lateral roots when external nitrate concentration is low or null. May be involved in the basipetal transport of auxin out of the lateral root tips. Acts as a bidirectional transporter involved in root-to-shoot nitrate translocation. Recognizes specifically nitrate and chlorate, but not nitrite, alanine, sulfate, phosphate or the di-peptide Ala-Ala.
  subunit: Monomer and homodimer. The dimer has the 2 monomers in the same orientation. Interacts with CIPK23.
  disruption phenotype: Altered development of nascent organs. Reduced stomatal opening and reduced transpiration rates in the light resulting in enhanced drought tolerance. Slower translocation of nitrate to the leaves.
• substrates: Chlorate, nitrate
  tcdb comment: The low affinity form is a homo-dimer and has Thr101 in the non-phosphorylated form; the high affinty form (0.1 micromolar Km) is a monomer and has Thr101 phosphorylated (Sun and Zheng 2015)
• A Numbering System for MFS Transporter Proteins
  Lee, Frontiers in molecular biosciences 2016
  • “...cell Homo sapiens PiPT SP A8N031 Phosphate/H + symport Into cell Piriformospora indica NRT1.1 NRT1/PTR Q05085 Nitrite/H + symport Into cell Arabidopsis thaliana NarU NNP P37758 Nitrate/nitrite symport Into cell E. coli XylE SP P0AGF4 Xylose/H + symport Into cell E. coli MelB Glycoside-pentoside-hexuronide: cation symporter...”
• Method to increase the yield of eukaryotic membrane protein expression in Saccharomyces cerevisiae for structural and functional studies
  Parker, Protein science : a publication of the Protein Society 2014
  • “...PTR1 Q9M390 12 64 ScVRG4 Saccharomyces cerevisiae VRG4 P40107 10 37 AtNRT1.1 A. thaliana NRT1.1 Q05085 12 64.9 SlCAT9 Solanum lycopersicum CAT9 K4CYY3 13 60.4 ScAVT1 S. cerevisiae AVT1 P47082 11 65.3 ScAVT2 S. cerevisiae AVT2 P39981 11 53.3 HsENT1 Homo sapien ENT1 Q99808 11 50.2...”
• Molecular basis of nitrate uptake by the plant nitrate transporter NRT1.1
  Parker, Nature 2014
  • “...of At NRT1.1 with PTR family members. Amino acid alignment of A. thaliana NRT1.1 (Uniprot: Q05085) with PepT So (Q8EKT7), PepT St (Q5M4H8), human PepT1 (B2CQT6) and PepT Gk (Q5KYD1) using MAFFT (Katoh & Toh, 2008) with manual adjustment in JalView (Clamp et al, 2004). AtNRT1.1...”
• Nitrogen transporter and assimilation genes exhibit developmental stage-selective expression in maize (Zea mays L.) associated with distinct cis-acting promoter motifs
  Liseron-Monfils, Plant signaling & behavior 2013
  • “...Nitrate and chloride transporter 1 ZmN-13 BAA35120.1 GRMZM2G077054; GRMZM2G085078; GRMZM2G375064 NADH-dependent glutamate synthase 1 ZmN-12 Q05085 GRMZM2G086496 Nitrate transporter (nrt1.1) 1 ZmN-11 AAL05612.1 AC208641.3_FG005; AC208641.3_FG008; GRMZM2G028736; GRMZM2G175140; GRMZM2G335218 Ammonium transporter (Osamt1.1) 1 ZmN-10* No Description N/A Symbiotic ammonium transporter 1 ZmN-9^ BAC56913.1 GRMZM2G086496 Nitrate transporter (nrt1.1)...”
• SolEST database: a "one-stop shop" approach to the study of Solanaceae transcriptomes
  D'Agostino, BMC plant biology 2009
  • “...| Serpin-ZX OS = Arabidopsis thaliana 4 CU914524.3 43123 43880 1 AC233501.1 77665 78422 SOLLC007010:Contig1 Q05085 | CHL1_ARATH | Nitrate/chlorate transporter OS = Arabidopsis thaliana 4 CU914524.3 52979 54985 1 AC233501.1 40918 42609 SOLLC005747:Contig1 Q05085 | CHL1_ARATH | Nitrate/chlorate transporter OS = Arabidopsis thaliana 4 CU914524.3...”
• Transceptor NRT1.1 and receptor-kinase QSK1 complex controls PM H+-ATPase activity under low nitrate.
  Zhu, Current biology : CB 2024 (PubMed)
  • GeneRIF: Transceptor NRT1.1 and receptor-kinase QSK1 complex controls PM H[+]-ATPase activity under low nitrate.
• Arabidopsis NPF2.13 functions as a critical transporter of bacterial natural compound tunicamycin in plant-microbe interaction.
  Liu, The New phytologist 2023 (PubMed)
  • GeneRIF: Arabidopsis NPF2.13 functions as a critical transporter of bacterial natural compound tunicamycin in plant-microbe interaction.
• The Arabidopsis eIF4E1 regulates NRT1.1-mediated nitrate signaling at both translational and transcriptional levels.
  Li, The New phytologist 2023 (PubMed)
  • GeneRIF: The Arabidopsis eIF4E1 regulates NRT1.1-mediated nitrate signaling at both translational and transcriptional levels.
• Pseudomonas aeruginosa LasI-dependent plant growth promotion requires the host nitrate transceptor AtNRT1.1/CHL1 and the nitrate reductases NIA1 and NIA2.
  López-Bucio, Planta 2023 (PubMed)
  • GeneRIF: Pseudomonas aeruginosa LasI-dependent plant growth promotion requires the host nitrate transceptor AtNRT1.1/CHL1 and the nitrate reductases NIA1 and NIA2.
• Abscisic acid signaling negatively regulates nitrate uptake via phosphorylation of NRT1.1 by SnRK2s in Arabidopsis.
  Su, Journal of integrative plant biology 2021 (PubMed)
  • GeneRIF: Abscisic acid signaling negatively regulates nitrate uptake via phosphorylation of NRT1.1 by SnRK2s in Arabidopsis.
• Enhanced NRT1.1/NPF6.3 expression in shoots improves growth under nitrogen deficiency stress in Arabidopsis.
  Sakuraba, Communications biology 2021
  • GeneRIF: Enhanced NRT1.1/NPF6.3 expression in shoots improves growth under nitrogen deficiency stress in Arabidopsis.
• STOP1 activates NRT1.1-mediated nitrate uptake to create a favorable rhizospheric pH for plant adaptation to acidity.
  Ye, The Plant cell 2021
  • GeneRIF: STOP1 activates NRT1.1-mediated nitrate uptake to create a favorable rhizospheric pH for plant adaptation to acidity.
• NRT1.1s in plants: functions beyond nitrate transport.
  Wang, Journal of experimental botany 2020
  • GeneRIF: NRT1.1s in plants: functions beyond nitrate transport.
• More
• Carbon and nitrogen signaling regulate FLOWERING LOCUS C and impact flowering time in Arabidopsis
  Gramma, Plant physiology 2024
  • “...paper: AP1 Gramene: AT1G69120 AP1 Araport: AT1G69120 MAF1 Gramene: AT1G77080 MAF1 Araport: AT1G77080 NRT1.1 Gramene: AT1G12110 NRT1.1 Araport: AT1G12110 NRT1.13 Gramene: AT1G33440 NRT1.13 Araport: AT1G33440 FLC Gramene: AT5G10140 FLC Araport: AT5G10140 TPS1 Gramene: AT1G78580 TPS1 Araport: AT1G78580 References Abe M , Kobayashi Y , Yamamoto S...”
• Nitrogen sensing and regulatory networks: it's about time and space
  Shanks, The Plant cell 2024
  • “...AT4G39400 BRI1 Araport: AT4G39400 NIN Gramene: Medtr5g099060 NIN Araport: Medtr5g099060 nitrate CHEBI: CHEBI:17632 NRT11/NPF63 Gramene: AT1G12110 NRT11/NPF63 Araport: AT1G12110 References Abualia R , tvs K , Novk O , Bouguyon E , Domanegg K , Krapp A , Nacry P , Gojon A , Lacombe B...”
• Nitrate Signaling and Its Role in Regulating Flowering Time in Arabidopsis thaliana
  Wang, International journal of molecular sciences 2024
  • “...in nitrate signaling. Gene Name Locus Protein Identity Roles in Nitrate Signaling Functions Reference NRT1.1 AT1G12110 NITRATE TRANSPORTER 1.1 (NRT1.1) Plasma membrane nitrate transceptor Sensing a wide range of external nitrate concentrations and generating different levels of the primary nitrate response (PNR) [ 1 ] CNGC15...”
• Beneficial Effects of Phosphite in Arabidopsis thaliana Mediated by Activation of ABA, SA, and JA Biosynthesis and Signaling Pathways
  Pérez-Zavala, Plants (Basel, Switzerland) 2024
  • “...HPi plants treated with Phi ( Figure S3 ). These genes included NITRATE TRANSPORTER 1 (AT1G12110), NITRATE TRANSPORTER 2 (AT1G08090), DEGRADATION OF UREA 3 (AT5G45380), XYLULOSE 5-PHOSPHATE/PHOSPHATE TRANSLOCATOR (AT5G17630), PHOSPHATE TRANSPORTER 1;4 (AT2G38940), PHOSPHATE TRANSPORTER 4;2 (AT2G38060), PHOSPHATE TRANSPORTER 3;1 (AT5G14040), PHOSPHOENOLPYRUVATE/PHOSPHATE TRANSLOCATOR (AT5G33320), along with...”
• Functional and Molecular Characterization of Plant Nitrate Transporters Belonging to NPF (NRT1/PTR) 6 Subfamily
  Nedelyaeva, International journal of molecular sciences 2024
  • “...Acid Residues Determining the Transporter Haplotype Functions and Physiological Roles References Arabidopsis thaliana AtNPF6.3 (NRT1.1/CHL1.1), AT1G12110, plasma membrane B Thr101/His356/Thr360/Phe511 THTF Dual-affinity nitrate transporter, auxin transport, nitrate signaling, chloride transport in the absence of nitrate [ 4 , 24 , 45 , 50 ] AtNPF6.2 (NRT1.4),...”
• ZmNRT1.1B (ZmNPF6.6) determines nitrogen use efficiency via regulation of nitrate transport and signalling in maize
  Cao, Plant biotechnology journal 2024
  • “...this study can be found in the GenBank libraries under the following accession numbers: AtNRT1.1, AT1G12110; OsNRT1.1A, Os08g05910; OsNRT1.1B, Os10g40600; OsNRT1.1C, Os03g01290; ZmNRT1.1A, GRMZM2G086496; ZmNRT1.1B, GRMZM2G161459; ZmNRT1.1C, GRMZM2G112154; ZmNRT1.1D, GRMZM2G161483; ZmNLP3.1, GRMZM2G375675; ZmNR1.1, GRMZM5G878558; ZmNR1.2, GRMZM2G428027; ZmNIR1.1, GRMZM2G079381; ZmNRT2.1, GRMZM2G010280; ZmIPT6, GRMZM2G116878; ZmCKX6, GRMZM2G404443; ZmCYP735A2, GRMZM2G022904;...”
• Phosphoregulation in the N-terminus of NRT2.1 affects nitrate uptake by controlling the interaction of NRT2.1 with NAR2.1 and kinase HPCAL1 in Arabidopsis
  Li, Journal of experimental botany 2024
  • “...modifications. Post-translational control of nitrate transport activity is well described for the dual-affinity transporter NRT1.1 (AT1G12110) ( Liu et al. , 1999 ; Guo et al. , 2001 ). In NRT1.1, phosphorylation at T01 acts as a switch. When T101 is phosphorylated, NRT1.1 functions as a...”
• Identification and Functional Characterization of MdNRT1.1 in Nitrogen Utilization and Abiotic Stress Tolerance in Malus domestica
  Liu, International journal of molecular sciences 2023
  • “...was screened in the GDR ( https://www.rosaceae.org/ , accessed on 5 November 2021) using AtNRT1.1 (AT1G12110) as the query. MdNRT1.1 (MD15G1173800) was identified, and NRT1.1 homologs from 15 species were identified to construct the evolutionary tree ( Figure 1 A). The data illustrated that apple MdNRT1.1...”
• More

LOC104780607 protein NRT1/ PTR FAMILY 2.10-like from Camelina sativa
24% identity, 83% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...Accession numbers The following sequences were included in this study: CsGTR1A, B, C, LOC104711273, LOC104791006, LOC104780607; CsGTR2A, B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors declare...”

PTR22_ARATH / Q8VZE2 Protein NRT1/ PTR FAMILY 5.14; AtNPF5.14; Nitrate transporter 1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G72120 transporter from Arabidopsis thaliana
25% identity, 97% coverage

• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...3.57 x Nitrate (NPF family) NPF5.12 At1g72140 2.03 x x x Nitrate (NPF family) NPF5.14/NRT1.15 At1g72120 x 1.83 x x Nitrate (NPF family) NPF6.2/NRT1.4 At2g26690 x x 2.11 1.61 Ammonium (AMT family) AMT13 At3g24300 x 2.42 x X Ammonium (AMT family) AMT14 At4g28700 x x x...”
• QTL analysis of the developmental response to L-glutamate in Arabidopsis roots and its genotype-by-environment interactions
  Walch-Liu, Journal of experimental botany 2017
  • “...a cluster of four genes belonging to the same family as the NRT1 nitrate transceptor: At1g72120 ( NRT1.15/AtNPF5.14 ), At1g72125 ( NRT1.16/AtNPF5. 13), At1g72130 ( AtNPF5.11 ), At1g72140 ( AtNPF5.12 ). The NPF family in Arabidopsis has 53 members belonging to 8 subfamilies and between them...”
• Large-scale analysis of differential gene expression in coffee genotypes resistant and susceptible to leaf miner-toward the identification of candidate genes for marker assisted-selection
  Cardoso, BMC genomics 2014
  • “...s-transferase gstu6 -6,85 0D35 SGN-E1317104 0 Aspartyl protease family protein -6,74 0D36 SGN-E1322588 1e -180 at1g72120 f28p5_2 -6,53 0D37 NM ---NA--- -6,46 0D38 SGN-E1350292 0 Lactoylglutathione lyase family protein -6,46 0D39 NM Achain crystal structure of a cell-wall invertase from Arabidopsis thaliana in complex with sucrose...”

PTR49_ARATH / Q9LYR6 Protein NRT1/ PTR FAMILY 6.1; AtNPF6.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G13400 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
25% identity, 86% coverage

• Genome-Wide Association Study of Natural Variation in Arabidopsis Exposed to Acid Mine Drainage Toxicity and Validation of Associated Genes with Reverse Genetics
  Ghimire, Plants (Basel, Switzerland) 2021
  • “...they might have a critical role in AMD-stress tolerance. For root diameter, we found that At5g13400, a transmembrane transporter gene, co-expressed with At5g08640 (flavonol synthase 1), and At4g13840 (eceriferum 26; CER26). Also, At3g52820 (purple acid phosphatase 22) and At4g13800 (magnesium transporter) show co-expression ( Figure S5E...”
• Transcriptomics Reveals Fast Changes in Salicylate and Jasmonate Signaling Pathways in Shoots of Carbonate-Tolerant Arabidopsis thaliana under Bicarbonate Exposure
  Pérez-Martín, International journal of molecular sciences 2021
  • “...and EXT21 ( AT2G43150 ) suggests fast bic influence on leaf cell walls. Upregulation of AT5G13400 coding for the nitrate transporter NRT1, as well as downregulation of AAP4 , responsible for phloem export of amino acids, is in line with enhanced nitrogen requirement in bic-stressed leaves....”
• Analysis of the impact of indole-3-acetic acid (IAA) on gene expression during leaf senescence in Arabidopsis thaliana
  Gören-Sağlam, Physiology and molecular biology of plants : an international journal of functional plant biology 2020
  • “...responsive A/B Barrel Domaincontaining protein 2 1 At5g13400 Proton-dependent oligopeptide transport (POT) family protein 2 1 At4g33050 EMBRYO SAC DEVELOPMENT...”
• Differentially expressed genes during the imbibition of dormant and after-ripened seeds - a reverse genetics approach
  Yazdanpanah, BMC plant biology 2017
  • “...40 Delta vacuolar processing enzyme (DELTA-VPE) SAIL_547_D05 AT4G31330 KO 41 Protein of unknown function SALK_007230.56.00.x AT5G13400 KO 42 Peptide transporter 5 SALK_017818.55.50.x AT2G45180 KO 43 Lipid-transfer protein/seed storage 2S albumin superfamily protein SALK_095678 AT1G07890 KO 44 Ascorbate peroxidase 1 (APX1) SALK_090550.52.85.x AT1G47128 KO 45 Responsive to...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...members were clustered in species-specific distinct clades, and only four pairs of orthologs (Os01g01360 and At5g13400, Os01g37590 and At2g26690, Os06g15370 and At1g68570, Os05g27010 and At2g40460) could be figured out. This result indicated that the main characteristics of PTR family in rice and Arabidopsis were formed before...”

XP_008679038 protein NRT1/ PTR FAMILY 7.3 isoform X2 from Zea mays
25% identity, 95% coverage

• Genomic survey of NPF and NRT2 transporter gene families in five inbred maize lines and their responses to pathogens infection.
  Xia, Genomics 2023 (PubMed)
  • GeneRIF: Genomic survey of NPF and NRT2 transporter gene families in five inbred maize lines and their responses to pathogens infection.

NP_001145735 uncharacterized protein LOC100279242 from Zea mays
25% identity, 94% coverage

• Maize NPF6 Proteins Are Homologs of Arabidopsis CHL1 That Are Selective for Both Nitrate and Chloride.
  Wen, The Plant cell 2017
  • GeneRIF: The protein is localized to the plasma membrane. Xenopus oocytes injected with cDNA exhibit: pH-dependent, inward, low affinity, nitrate flux; pH-dependent, inward high affinity chloride flux; chloride-selective transport. In vitro site-mutagenesis shows that Y370 is involved in selectivity of nitrate and chloride transport.

LOC104776006 protein NRT1/ PTR FAMILY 2.9-like from Camelina sativa
23% identity, 92% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors declare no conflict of interest. Author contributions G.H. and P.D. designed the experiments and wrote the manuscript. G.H....”

LOC4348864 protein NRT1/ PTR FAMILY 5.2 from Oryza sativa Japonica Group
Q7XDJ1 Os10g0469900 protein from Oryza sativa subsp. japonica
24% identity, 92% coverage

• Functional analysis of the OsNPF4.5 nitrate transporter reveals a conserved mycorrhizal pathway of nitrogen acquisition in plants
  Wang, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...OsNPF6.4 (LOC9271131), OsPT11 (LOC4324187), OsHA1 (LOC4331281), OsNAR2.1 (LOC4329861), OsNRT2.1 (LOC4328051), OsNRT2.2 (LOC4328052), OsNPF1.3 (LOC4327022), OsNPF5.4 (LOC4348864), OsNPF7.2 (LOC4330372), OsNPF8.3 (LOC4336852), OsAMT3.1 (LOC107276856), OsNR1 (LOC4330867), OsNR2 (LOC4345798), OsGS1.1 (LOC4330649), MtNPF4.5 (LOC11406786), ZmNPF4.5 (LOC103652484), and SbNPF4.5 (LOC8062188). Supplementary Material Supplementary File Supplementary File This work was supported by...”
• An integrated "omics" approach to the characterization of maize (Zea mays L.) mutants deficient in the expression of two genes encoding cytosolic glutamine synthetase.
  Amiour, BMC genomics 2014
  • “...TC273598 C metabolism Beta-glucosidase 31 {Os} B7F7K7 0.08 TC273931 Transport Putative peptide transport protein {Os} Q7XDJ1 0.08 TC207366 Signalling Putative calcium-dependent protein kinase {Os} Q6I587 0.08 TC254765 Stress/Defence Glutathione S-transferase GST 34 {Zm} Q9FQA5 0.07 CF029576 Transcription SCARECROW gene regulator, putative related cluster {Os} Q53MB4 0.07...”

D5LQ68 ABC-type nitrate transporter (EC 7.3.2.4) from Medicago truncatula (see paper)
26% identity, 92% coverage

LOC9271131 protein NRT1/ PTR FAMILY 6.3 from Oryza sativa Japonica Group
26% identity, 95% coverage

• Functional analysis of the OsNPF4.5 nitrate transporter reveals a conserved mycorrhizal pathway of nitrogen acquisition in plants
  Wang, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...this article can be found in NCBI with the following accession numbers: OsNPF4.5 (LOC9271385), OsNPF6.4 (LOC9271131), OsPT11 (LOC4324187), OsHA1 (LOC4331281), OsNAR2.1 (LOC4329861), OsNRT2.1 (LOC4328051), OsNRT2.2 (LOC4328052), OsNPF1.3 (LOC4327022), OsNPF5.4 (LOC4348864), OsNPF7.2 (LOC4330372), OsNPF8.3 (LOC4336852), OsAMT3.1 (LOC107276856), OsNR1 (LOC4330867), OsNR2 (LOC4345798), OsGS1.1 (LOC4330649), MtNPF4.5 (LOC11406786), ZmNPF4.5 (LOC103652484),...”

LOC106758789 protein NRT1/ PTR FAMILY 7.3 from Vigna radiata var. radiata
25% identity, 86% coverage

• Advancing crop improvement through GWAS and beyond in mung bean
  Ahmed, Frontiers in plant science 2024
  • “...GAPIT, BLUPs, FarmCPU, Numericware-i, STRUCTURE, PLINK, SNPhylo, DISTRUCT, R-programming, CLUMPP, adegenet LOC106774729, LOC106774729, LOC106774729, LOC106756462, LOC106758789, LOC106759308, LOC106760769, LOC106764910, LOC106772003, LOC106773047, LOC106774971 Chr.1, Chr.2, Chr.4, Chr.5, Chr.6, Chr.8, Chr.9, Chr.10 Sequencing, Histogram plots, Statistical analysis, Molecular markers ( Sandhu and Singh, 2021 ) AVRDC mini-core collection...”

PTR8_ARATH / Q9M9V7 Protein NRT1/ PTR FAMILY 2.9; AtNPF2.9; Nitrate transporter 1.9 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
AT1G18880 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
NP_173322 Major facilitator superfamily protein from Arabidopsis thaliana
23% identity, 91% coverage

• function: Low-affinity nitrate transporter facilitating nitrate loading into root phloem. Not involved in dipeptides transport, but has a weak glucosinolate transport activity.
  disruption phenotype: Decreased nitrate content in root phloem exudates. Enhanced root-to shoot nitrate transport and plant growth under high nitrate conditions.
• First Come, First Served: Sui Generis Features of the First Intron
  Zalabák, Plants (Basel, Switzerland) 2020
  • “...Arabidopsis [ 34 ] n.a. (At5g08185) downstream source of miR162a Arabidopsis [ 131 ] NPF2.9/NRT1.9 (At1g18880) downstream source of miR837 Arabidopsis [ 131 ] n.a. (At2g23348) upstream source of miR844 Arabidopsis [ 131 ] PIF3 (At1g09530) upstream target of HID1 Arabidopsis [ 36 ] IR secondarystructure...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...At3g45650 NPF22 NO 3 [ 52 ]; GA 1/3/4 /MeJA [ 18 ] AtNPF2.9 NRT1.9/GTR3 At1g18880 NPF21 NO 3 [ 53 ]; 4MTB [ 20 ] AtNPF2.10 GTR1 At3g47960 NPF21 NO 3 /4MTB [ 20 ]; 8MTO [ 47 ]; GA 1/3/4 /MeJA [ 18 ,...”
• Lateral Transport of Organic and Inorganic Solutes
  Aubry, Plants (Basel, Switzerland) 2019
  • “...Nitrate transporter Root Xylem parenchyma Promoter GUS and in situ hybridization At/[ 130 ] NRT1.9/NPF2.9 At1g18880 Nitrate transporter Root Phloem companion cells Promoter GUS and GFP fusion protein At/[ 131 ] NRT1.11/NPF1.2 At1g52190 Nitrate transporter Leaf Phloem companion cells Promoter GUS and GFP fusion protein At/[...”
• Transmembrane transport and stress response genes play an important role in adaptation of Arabidopsis halleri to metalliferous soils
  Sailer, Scientific reports 2018
  • “...of associated SNPs Gene name Enriched gene pathway Tajimas D M_PL22 M_PL27 NM_PL14 NM_PL35 Site-type AT1G18880 2351 35 2 Nitrate transporter 1.9/NFP2.9 SLC-mediated transmembrane transport 3.13 1.54 2.47 0.91 AT1G47840 2800 78 2 Hexokinase 3 SLC-mediated transmembrane transport 0.89 0.46 1.61 3.14 AT3G15380 3484 80 1...”
• Identification of Iridoid Glucoside Transporters in Catharanthus roseus
  Larsen, Plant & cell physiology 2017
  • “...obtainable, commercially available iridoid glucoside, loganin. Two transporters were identified: the indole-specific glucosinolate transporter AtNPF2.9 (At1g18880) ( Jrgensen et al . 2017 ) and the putative nucleobase ascorbate transporter AtNAT4 (At1g49960). AtNPF2.9 is a member of the NRT1/PTR family (NPF) and a close homolog of the...”
  • “...Moerkercke et al . 2013 ) ( www.cathacyc.org )] using the nucleotide sequence of AtNPF2.9 (AT1G18880) and CRG200 (Genbank accession AM232415, corresponding to CrNPF2.1; Caros007724.1) ( Rischer et al . 2006 ) as query, transcripts corresponding to at least 40 NPF proteins were identified. To obtain...”
• Origin and evolution of transporter substrate specificity within the NPF family
  Jørgensen, eLife 2017
  • “...(4MTB) representing a highly abundant aliphatic glucosinolate in A. thaliana ( Figure 1AB ). NPF2.9 (At1g18880, hereafter GTR3) - the closest homolog of GTR1 and GTR2 - transported I3M effectively ( Figure 1C ). Two Electrode Voltage Clamp (TEVC) electrophysiology and time-course uptake assays showed that...”
• Pre-symptomatic transcriptome changes during cold storage of chilling sensitive and resistant peach cultivars to elucidate chilling injury mechanisms
  Pons, BMC genomics 2015
  • “...Na/ K antiporter PPN064A01 Na+/ H+ antiporter AT2G01980 SOS1 Nitrate transport PPN024D02 Nitrate transporter NRT1-2 AT1G18880 NRT1.9 Oligopepetide transport PPN005F03 Oligopeptide transporter 7 AT4G10770 OPT7 PPN064F08 POT family, putative AT1G59740 NRT1/NPF4.3 Unknown transporter PPN066F09 Putative integral membrane protein AT5G19980 GONST4 Sugar partioning and homeostasis Is probably...”
• Complex phylogeny and gene expression patterns of members of the NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER family (NPF) in wheat
  Buchner, Journal of experimental botany 2014
  • “...N/A N/A AtNPF2.13 At1g69870 BdNPF2.6 Bradi2g58470 OsNPF2.5 Loc_Os01g68510 AtNPF7.2 At4g21680 N/A N/A N/A N/A AtNPF2.9A At1g18880 BdNPF2.4 Bradi4g00530 OsNPF2.2 OsNPF2.3 Loc_Os12g44100 Loc_Os12g44110 AtNPF2.10 At3g47960 N/A N/A N/A N/A AtNPF2.11 At5g62680 N/A N/A N/A N/A AtNPF1.2 At1g52190 BdNPF1.2 Bradi2g50580 OsNPF1.2 Loc_Os01g55610 Phylogenetic analysis was performed by multiple...”
  • “...Fig. 1 ). Plett et al. (2010) did not include the Arabidopsis NPF genes for At1g18880 ( AtNPF2.9 ), At3g47960 ( AtNPF2. 10) and At5g62680 ( AtNPF2.11 ). Tsay et al. (2007) reported nitrate transporter activity for the AtNPF2.9 and AtNPF2.11 gene products. Further analysis by...”
• More
• Arabidopsis nitrate transporter NRT1.9 is important in phloem nitrate transport.
  Wang, The Plant cell 2011
  • GeneRIF: Phloem nitrate transport is facilitated by expression of NRT1.9 in root companion cells. In addition, enhanced root-to-shoot xylem transport of nitrate in nrt1.9 mutants points to a negative correlation between xylem and phloem nitrate transport.

GRMZM2G472167 peptide transporter PTR2 from Zea mays
24% identity, 88% coverage

• Identification of Genomic Regions Associated with Agronomic and Disease Resistance Traits in a Large Set of Multiple DH Populations
  Sadessa, Genes 2022
  • “...Dof zinc finger protein DOF3.6-like and O-fucosyltransferase 36 synthesis biological functions; whereas the candidate genes, GRMZM2G472167 on chromosome 1 and GRMZM2G019404 on chromosome 2, identified under WS were functionally described as peptide transporter PTR2 mha2 that involved in seed germination maternal control and plasma-membrane H+ATPase 2...”
  • “...1 4.07 10 6 0.09 0.23 GRMZM2G072814 uncharacterized S1_285928879 1 1.07 10 6 0.09 0.23 GRMZM2G472167 peptide transporter PTR2 S2_4269206 2 2.99 10 7 0.13 0.18 GRMZM2G019404 plasma-membrane H+ATPase 2 S4_168744841 4 7.33 10 6 0.13 0.17 GRMZM2G422190 uncharacterized S4_177585059 4 5.13 10 8 0.21 0.18...”

GRMZM2G083176 Protein NRT1/ PTR FAMILY 6.1 from Zea mays
C0PLZ2 Protein NRT1/ PTR FAMILY 6.1 from Zea mays
25% identity, 80% coverage

• Validating a Major Quantitative Trait Locus and Predicting Candidate Genes Associated With Kernel Width Through QTL Mapping and RNA-Sequencing Technology Using Near-Isogenic Lines in Maize
  Zhao, Frontiers in plant science 2022
  • “...were detected in the identified qKW-1 physical interval by blasting with the Zea_Mays_B73 v4 genome. GRMZM2G083176 encodes the NiemannPick disease type C, and GRMZM2G081719 encodes the nitrate transporter 1 (NRT1) protein. The two genes GRMZM2G083176 and GRMZM2G081719 were predicted to be candidate genes of qKW-1. Reverse...”
  • “...results. The sequences of the primers are listed as follows: Actin (F: GTCCATGAGGCCACGTACAA; R: CCGGACCAGTTTCGTCATA), GRMZM2G083176 (F: GTTCA TGGCTAGATCCGGCA; R: ACGAAGTGAGATGACGACGG), and GRMZM2G081719 (F: CCGGCCACCATCAAGAAGAT; R: CTCCGGTAATGTCTCTGGG). The reaction system and reaction procedure are shown in Supplementary Tables 3 , 4 . Results Quantitative Trait Locus...”
• Phosphoproteomic analysis of the response of maize leaves to drought, heat and their combination stress.
  Hu, Frontiers in plant science 2015
  • “...2559 574595 43.66 4 xxxxxxxxx RT xxxxxxxxxx B4FB20; B4FGQ4; B4FQU2; B4FRV0; BF4F7W7; B6SRZ6; C0HE61; C0PLM8; C0PLZ2; K7V4D9; K7VD18 7.28 11 29 27693 572036 7.84 DH 1 xxxxxxx R xx S xxxxxxxxx A3KLI0; BF4F976; B4FI93; B4FRF2; B4FUV7; B4FXQ9; B6SJ15; B6SRZ6; B6SXN6; B6T1H0; B6T2A6; B6T346; B6TDN3; B6TWH2; B7ZYP6;...”
  • “...31 29395 574595 6.31 5 xxxxxxxxx RT xxxxxxxxxx BF4F7W7; B4FB20; B4FGQ4; B4FQU2; B6SRZ6; C0HE61; C0PLM8; C0PLZ2; K7V4D9 5.44 9 21 26513 545200 7.83 x represents any amino acid . The signaling pathways associated with phosphorylated proteins under various stress conditions All identified phosphoproteins were classified using...”

XP_003590804 protein NRT1/ PTR FAMILY 5.2 from Medicago truncatula
23% identity, 92% coverage

• Genome wide transcriptional profile analysis of Vitis amurensis and Vitis vinifera in response to cold stress
  Xin, PloS one 2013
  • “...51 GSVIVT01007624001 BAI63584 component of high affinity nitrate transporter [Lotus japonicus] 1.09E-86 transport 29 GSVIVT01027876001 XP_003590804 Peptide transporter PTR3-A [Medicago truncatula] 0 transport 21 GSVIVT01026228001 XP_003589717 Chaperone protein dnaJ [Medicago truncatula] 2.77E-167 protein folding 107 GSVIVT01020783001 XP_002525886 small heat-shock protein, putative [Ricinus communis] 6.17E-102 protein folding...”

LOC105851115 protein NRT1/ PTR FAMILY 3.1-like from Cicer arietinum
25% identity, 88% coverage

• Morphophysiological and transcriptome analysis reveal that reprogramming of metabolism, phytohormones and root development pathways governs the potassium (K⁺) deficiency response in two contrasting chickpea cultivars
  Ankit, Frontiers in plant science 2022
  • “...-1.2 Down Ion transport associated DEGs PUSA362 LOC101497071 probable inorganic phosphate transporter 1-3 5.8 Up LOC105851115 protein NRT1/PTR FAMILY 3.1-like 1.6 Up LOC101512428 vacuolar iron transporter homolog 4-like -4.4 Down LOC101503875 high affinity nitrate transporter 2.4 -2.6 Down LOC101506906 high affinity nitrate transporter 2.5 -1.2 Down...”

LOC104711273 protein NRT1/ PTR FAMILY 2.10 from Camelina sativa
23% identity, 83% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...S5 . Accession numbers The following sequences were included in this study: CsGTR1A, B, C, LOC104711273, LOC104791006, LOC104780607; CsGTR2A, B, C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The...”

PTR28_ARATH / P0CI03 Protein NRT1/ PTR FAMILY 5.6; AtNPF5.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT2G37900 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
23% identity, 92% coverage

• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...x 2.3 Nitrate (NPF family) NPF5.3/NRT1.8 At5g46040 x 4.1 x x Nitrate (NPF family) NPF5.6 At2g37900 x x 3.57 x Nitrate (NPF family) NPF5.12 At1g72140 2.03 x x x Nitrate (NPF family) NPF5.14/NRT1.15 At1g72120 x 1.83 x x Nitrate (NPF family) NPF6.2/NRT1.4 At2g26690 x x 2.11...”
• Distinct guard cell-specific remodeling of chromatin accessibility during abscisic acid- and CO₂-dependent stomatal regulation
  Seller, Proceedings of the National Academy of Sciences of the United States of America 2023
  • “...C and Dataset S5 ). For instance, ABA-regulated expression of the major facilitator protein-encoding gene AT2G37900 and the gene AAE9 was only evident in guard cells ( SI Appendix , Fig. S5 E ). Fig. 3. ABA triggers extensive and persistent chromatin remodeling in guard cells....”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...At5g46040 NPF51 ABA [ 18 ] AtNPF5.5 At2g38100 NPF52 NO 3 [ 61 ] AtNPF5.6 At2g37900 NPF51 GA 1/4 [ 18 ] AtNPF5.7 At3g53960 NPF51 ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF5.10 At1g22540 NPF51 NO 3 [ 61 ] AtNPF6.2 NRT1.4 At2g26690 NPF61 NO 3 [...”
• Expression profiling of tomato pre-abscission pedicels provides insights into abscission zone properties including competence to respond to abscission signals
  Nakano, BMC plant biology 2013
  • “...AT1G59740 proton-dependent oligopeptide transport (POT) family protein 1.9 0.023 2.0 0.034 Solyc10g084950 a A_96_P231269 DB697130 AT2G37900 proton-dependent oligopeptide transport (POT) family protein 2.6 0.005 2.5 0.026 Solyc07g063930 A_96_P137262 AI778966 AT3G20660 AtOCT4 (Arabidopsis thaliana ORGANIC CATION/CARNITINE TRANSPORTER4) 3.0 0.002 1.7 0.003 Solyc03g005980 A_96_P190219 BG134199 AT4G18910 NIP1;2 (NOD26-LIKE...”
• A genomic approach to investigate developmental cell death in woody tissues of Populus trees
  Moreau, Genome biology 2005
  • “...protein family 6 At2g27390 1.6E-18 Membrane 2.5 0.00015 3.1 11639 Oligopeptide transport family protein 5 At2g37900 1.3E-05 Membrane 2.8 0.00076 1.5 11646 Expressed protein 4 At2g22080 6.1E-01 Endomembrane system 7.9 0.0000091 7.2 11619 Expressed protein 4 At3g45160 2.8E-10 Endomembrane system 4.8 0.0000061 7.8 11625 Transferase family...”

LOC111202315 protein NRT1/ PTR FAMILY 2.10 from Brassica napus
24% identity, 93% coverage

• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...cv. ZS11 (Bra_napus_v2.0) and six paralogs of BnGTR1 ( LOC106397267, LOC106408997, LOC106410496, LOC106414122, LOC106445255 and LOC111202315 ) and six paralogs of BnGTR2 ( LOC106347844, LOC106366161, LOC106369007, LOC106405453, LOC106411192 and LOC106424883 ) were found ( Table 8 ). Genomic and full-length open reading frames of six BnGTR1...”
  • “...LOC106410496 2649 4 1848 BnGTR1 LOC106414122 2666 4 1848 BnGTR1 LOC106445255 2988 4 1905 BnGTR1 LOC111202315 2685 4 1848 AtGTR2 BnGTR2 LOC106347844 2842 4 1839 BnGTR2 LOC106366161 2755 4 1839 BnGTR2 LOC106369007 8538 4 1839 BnGTR2 LOC106405453 2453 4 1839 BnGTR2 LOC106411192 2868 4 1836 BnGTR2...”

PTR31_ARATH / Q9SRI2 Protein NRT1/ PTR FAMILY 5.9; AtNPF5.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G01350 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
24% identity, 94% coverage

• Two NPF transporters mediate iron long-distance transport and homeostasis in Arabidopsis
  Chen, Plant communications 2021
  • “...mechanism ( Liu etal., 2015 ). The current research identified and functionally characterized the NPF5.9/ At3g01350 gene ( Leran etal., 2014 ), which is strongly responsive to Fe starvation. Our study revealed that NPF5.9 preferentially expresses in vascular tissues and localizes to the trans -Golgi network....”
• Evidence for phloem loading via the abaxial bundle sheath cells in maize leaves
  Bezrutczyk, The Plant cell 2021
  • “...homologous to Zm-UmamiT20a ( Supplemental Figure S6 ). G and H, At-NPF5.8 (AT5G14940)_ and At-NPF5.9 (AT3G01350) are homologous to Zm-NRT1 . Figure 4 SWEET13a is localized to abaxial bundle sheath cells of rank-2 veins. GUS histochemistry in leaves of maize lines transformed with the translational fusion...”
• NPF transporters in synaptic-like vesicles control delivery of iron and copper to seeds
  Chao, Science advances 2021
  • “...strains expressing AhNAS3 and an NPF family member NPF5.8 (At5g14940) or its close homolog NPF5.9 (At3g01350), indicating that the two genes encode proteins facilitating efflux of NA out of yeast cells ( Fig. 1C and fig. S2). The two proteins share 84% similarity, and the sequences...”
• Pre-symptomatic transcriptome changes during cold storage of chilling sensitive and resistant peach cultivars to elucidate chilling injury mechanisms
  Pons, BMC genomics 2015
  • “...C2 AT3G12100 MTP5 PPN007G12 Metal transporter Nramp3 AT2G23150 ATNRAMP3 Oligopepetide transport PPN029A02 Putative peptide transporter AT3G01350 Abbreviations : AUX : auxin; ET ; ethylene; ABA : Abcisic acid; PM : plasma membrane; CW : cell wall; SCW : secondary cell wall; ER : endoplasmic reticulum; MVB...”
• AGAMOUS controls GIANT KILLER, a multifunctional chromatin modifier in reproductive organ patterning and differentiation
  Ng, PLoS biology 2009
  • “...3-CAK, AT3G51850; 3-EDF, AT3G58680; 3-HAT, AT3G01470; 3-HUN, AT3G21690; 3-KIN, AT3G61410; 3-KIS, AT3G44050; 3-MYB, AT3G29020; 3-PET, AT3G01350; 3-RAS, AT3G11730; 3-RBL, AT3G50330; 3-REX, AT3G06140; 3-RIN, AT3G19950; 3-SIG, AT3G53920; 3-SUN, AT3G13180; 4-AG19, AT4G22950; 4-AG21, AT4G37940; 4-AIG, AT4G09950; 4-CEL, AT4G17615; 4-CHP, AT4G02180; 4-CLC, AT4G12550; 4-GL2, AT4G17710; 4-GLU, AT4G02290; 4-GLY, AT4G02480;...”

LOC104756232 protein NRT1/ PTR FAMILY 2.9-like from Camelina sativa
22% identity, 92% coverage

• Ablation of glucosinolate accumulation in the oil crop Camelina sativa by targeted mutagenesis of genes encoding the transporters GTR1 and GTR2 and regulators of biosynthesis MYB28 and MYB29
  Hölzl, Plant biotechnology journal 2023
  • “...C, LOC104762400, LOC104726867, LOC104740346; CsMYB28A, B, C, LOC104726729, LOC104762254, LOC104738807; CsGTR3A, B, C, LOC104740588, LOC104776006, LOC104756232; CsMYB29A, B, C, LOC104734792, LOC104768979, LOC104708326. Conflict of interest The authors declare no conflict of interest. Author contributions G.H. and P.D. designed the experiments and wrote the manuscript. G.H. managed...”

Q852B2 Os03g0823500 protein from Oryza sativa subsp. japonica
24% identity, 94% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
  Santi, Frontiers in plant science 2017
  • “...Putative oligopeptide transporter 2.85 GRMZM2G423884_T01 K7V9U9 Protein detoxification 2.79 GRMZM2G519761_T01 K7UHM7 Uncharacterized protein 2.64 GRMZM2G055834_T01 Q852B2 Os03g0823500 protein 2.64 GRMZM2G020859_T01 B6SV43 Potassium channel AKT2/3 2.36 GRMZM2G153961_T01 M7YVY5 ABC transporter B family member 11 2.34 GRMZM5G806774_T01 K3XV44 Glutamate receptor 2.23 GRMZM2G032899_T01 K7V706 Ammonium transporter 2.20 GRMZM2G011636_T01 A0A096PXD7...”

PTR47_ARATH / Q8GXN2 Protein NRT1/ PTR FAMILY 7.2; AtNPF7.2; Nitrate transporter 1.8 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
NP_193899 NITRATE TRANSPORTER 1.8 from Arabidopsis thaliana
AT4G21680 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
24% identity, 95% coverage

• function: Low-affinity nitrate transporter. Involved in nitrate removal from xylem sap. Not involved in oligopeptides transport.
  disruption phenotype: No visible phenotype. Higher nitrate concentration in xylem sap and increased cadmium sensitivity. A greater proportion of nitrate accumulates in shoots under cadmium stress.
• The Arabidopsis ethylene/jasmonic acid-NRT signaling module coordinates nitrate reallocation and the trade-off between growth and environmental adaptation.
  Zhang, The Plant cell 2014
  • GeneRIF: Data show that ethylene (ET) and jasmonic acid (JA)-nitrate transporters NRT1.8 and NRT1.5 signaling affect the crosstalk between stress-initiated nitrate allocation to roots (SINAR) and the environment.
• The Arabidopsis nitrate transporter NRT1.8 functions in nitrate removal from the xylem sap and mediates cadmium tolerance.
  Li, The Plant cell 2010
  • GeneRIF: Data suggests that NRT1.8-regulated nitrate distribution plays an important role in Cd(2+) tolerance. [NRT1.8]
• Volatile organic compounds from Lysinibacillus macroides regulating the seedling growth of Arabidopsis thaliana
  Zhao, Physiology and molecular biology of plants : an international journal of functional plant biology 2022
  • “...id Putative function At1g08090 Nitrate transporter 2.1 At4g21680 Nitrate transporter 1.8 At3g45060 High affinity nitrate transporter 2.6 At5g60780 Nitrate...”
• Endophytic bacterium Bacillus aryabhattai induces novel transcriptomic changes to stimulate plant growth
  Xu, PloS one 2022
  • “...9.7 WAT1-related protein AT5G09730 9.4 Beta-D-xylosidase AT1G61120 8.6 (E,E)-geranyllinalool synthase AT1G52400 7.8 Beta-D-glucopyranosyl abscisate beta-glucosidase AT4G21680 7.8 Protein NRT1/PTR FAMILY AT4G17470 7.7 Alpha/beta-hydrolase superfamily protein AT1G73220 7.5 Organic cation/carnitine transporter AT3G45140 7.3 Lipoxygenase AT4G15210 7.2 Beta-amylase AT1G54020 7.2 GDSL esterase/lipase ATMG00570 7.2 Sec-independent periplasmic protein translocase...”
• Endophytic Bacillus altitudinis Strain Uses Different Novelty Molecular Pathways to Enhance Plant Growth
  Zhang, Frontiers in microbiology 2021
  • “...repeat family protein AT4G22755 7.3 SMO13 AT3G44300 7.2 NIT2 AT1G73260 7.2 Kunitz trypsin inhibitor 1 AT4G21680 7.1 Protein NRT1/PTR family AT1G02205 7.1 Fatty acid hydroxylase superfamily ATMG00570 7.0 Sec-independent periplasmic protein translocase ATCG00190 6.6 DNA-directed RNA polymerase subunit beta AT2G43620 6.6 Endochitinase At2g43620 AT4G37150 6.1 MES9...”
• Molecular Targets and Biological Functions of cAMP Signaling in Arabidopsis
  Xu, Biomolecules 2021
  • “...in a pH-dependent manner and acts as vacuolar nitrate efflux transporters [ 181 ], NPF7.2/NRT1.8 (AT4G21680) functioning to remove nitrate from xylem vessels [ 182 ], NRT2.6 (AT3G45060) playing in the responses to challenges of microorganisms including plant growth-promoting rhizobacteria [ 183 ], and NPF2.7/NAXT1 (AT3G45650)...”
  • “...AtCNGC2 (AT5G15410), CAX7 (AT5G17860), CSC1-like proteins (AT1G10090; AT1G62320) K + AtKUP7 Nitrate NPF5.12 (AT1G72140), NPF7.2/NRT1.8 (AT4G21680), NRT2.6 (AT3G45060), NPF2.7/NAXT1(AT3G45650), CLC-b (AT3G27170) Sugar SWEET16 (AT3G16690), HKL1 (AT1G50460), PMT6/PLT6 (AT4G36670) Lipid MIOX2 (AT2G19800), ITPK3 (AT4G08170), SFH14 (AT5G56160) Light BG1 (AT5G12050), ERD7 (AT2G17840), KNAT4 (AT5G11060), DFL2 (AT4G03400), PKS1 (AT2G02950),...”
• The Loss of Function of the NODULE INCEPTION-Like PROTEIN 7 Enhances Salt Stress Tolerance in Arabidopsis Seedlings
  Le, Frontiers in plant science 2021
  • “...), NIA1 ( AT1G77760 ), NIA2 ( AT1G37130 ), NRT1.5 ( AT1G32450 ), NRT1.8 ( AT4G21680 ), NCED3 ( AT3G14440 ), BG1 ( AT3G57270 ), and BG2 ( AT3G57260 ), ACTIN2 ( AT3G18780 ). Statistical Analyses To obtain reliable results, each experiment was independently repeated at...”
• An amiRNA screen uncovers redundant CBF and ERF34/35 transcription factors that differentially regulate arsenite and cadmium responses
  Xie, Plant, cell & environment 2021
  • “...and targeted by EFR034 and ERF035. Gene ID Gene Symbol Gene description Fold change p-value AT4G21680 NRT1.8 NITRATE TRANSPORTER 1.8 29 0.0406 AT4G14680 APS3 Pseudouridine synthase/archaeosine transglycosylase-like family protein 12.3 0.0401 AT1G62300 WRKY6 WRKY family transcription factor 5.6 0.0327 AT4G01950 GPAT3 glycerol-3-phosphate acyltransferase 3 4.3 0.0367...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...NRT1.1/CHL1 At1g12110 NPF61 NO 3 [ 6 ]; IAA [ 19 ] IAA AtNPF7.2 NRT1.8 At4g21680 NPF7 NO 3 [ 53 ] AtNPF7.3 NRT1.5 At1g32450 NPF7 NO 3 [ 53 ]; K + [ 23 ] AtNPF8.1 PTR1 At3g54140 NPF8 di-peptides [ 13 , 14 ];...”
• Lateral Transport of Organic and Inorganic Solutes
  Aubry, Plants (Basel, Switzerland) 2019
  • “...At2g26690 Nitrate transporter Leaf Vascular system In situ hybridization At/[ 128 , 129 ] NRT1.8/NPF7.2 At4g21680 Nitrate transporter Root Xylem parenchyma Promoter GUS and in situ hybridization At/[ 130 ] NRT1.9/NPF2.9 At1g18880 Nitrate transporter Root Phloem companion cells Promoter GUS and GFP fusion protein At/[ 131...”
• More

LOC115699876 protein NRT1/ PTR FAMILY 4.5 from Cannabis sativa
24% identity, 95% coverage

• Sink strength, nutrient allocation, cannabinoid yield, and associated transcript profiles vary in two drug-type Cannabis chemovars
  Jost, Journal of experimental botany 2025
  • “...expressed in roots and stems of the THC- than the CBD-dominant chemovar. In both chemovars, LOC115699876, the homologue of the low-affinity Arabidopsis nitrate transporter NFP4.6 / NRT1.2 ( Huang et al. , 1999 ), was specifically expressed in flowers only, but with about 10-fold higher transcript...”
  • “...Cannabis ( Ren et al. , 2021 ). The two nitrate transporter genes, LOC115710913 and LOC115699876, were putatively selected in drug-type versus hemp-type Cannabis , while the nitrate reductase-encoding gene LOC115713111 had a positive selection signature in drug-type versus basal Cannabis accessions ( Fig. 9 ,...”

LOC106772114 protein NRT1/ PTR FAMILY 5.2 from Vigna radiata var. radiata
23% identity, 92% coverage

• Integrated Transcriptomic and Metabolic Framework for Carbon Metabolism and Plant Hormones Regulation in Vigna radiata during Post-Germination Seedling Growth
  Wang, Scientific reports 2020
  • “...54.976 * 2.8870.212 * 1.6030.160 * LOC106754175 45.186 * 102.854 * 3.2740.261 * 4.2950.589 * LOC106772114 50.572 * 149.266 * 8.0971.026 * 4.1000.889 * LOC106755252 114.279 * 248.152 * 42.9265.619 * 7.5381.560 * LOC106778742 21.863 * 23.031 * 4.9441.024 * 1.1600.141 LOC106772062 34.174 * 44.594 *...”

PTR44_ARATH / Q944G5 Protein NRT1/ PTR FAMILY 2.10; AtNPF2.10; Protein GLUCOSINOLATE TRANSPORTER-1 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
TC 2.A.17.3.17 / Q944G5 Transporter for glucosinolates (aliphatic but not indole glucosinolates such as 4-methylthiobutyl glucosinolate, major defence compounds, translocated to seeds on maturation) as well as gibberellic acid and jasmonoyl-L-isoleucine, GTR1 or NPF2.10, of 636 aas and 12 TMSs (Nour-Eldin et al. 2012; Ishimaru et al. 2017). Regulated at the transcriptional level, but also postranslationally from Arabidopsis thaliana (see 6 papers)
NP_566896 Major facilitator superfamily protein from Arabidopsis thaliana
24% identity, 84% coverage

• function: High-affinity, proton-dependent glucosinolate-specific transporter. Involved in the distribution of glucosinolates within the leaf, including import into the glucosinolate-rich S-cells located adjacent to the phloem. Involved in bidirectional long-distance transport of aliphatic but not indole glucosinolates. May be involved in removal of glucosinolates from the xylem in roots.
  disruption phenotype: No effect on the total glucosinolate levels in seeds. Gtr1 and gtr2 double mutant has no detectable glucosinolate in seeds.
• substrates: 4-methylthiobutyl glucosinolate, Alkyl glucosinolates, gibberellic acid, jasmonoyl-L-isoleucine
  tcdb comment: Dimerization of GTR1, possibly induced by dephosphorylation of a Thr residue, regulates its plasma membrane localization, leading to increased transport of glucosinolates and gibberellic acid (Ishimaru et al. 2017). Homologues have been found and characterized in Chinese kale (Jiang et al. 2019)
• Glucosinolate Transporter1 involves in salt-induced jasmonate signaling and alleviates the repression of lateral root growth by salt in Arabidopsis.
  Kuo, Plant science : an international journal of experimental plant biology 2020 (PubMed)
  • GeneRIF: Glucosinolate Transporter1 involves in salt-induced jasmonate signaling and alleviates the repression of lateral root growth by salt in Arabidopsis.
• Rhizosecretion of stele-synthesized glucosinolates and their catabolites requires GTR-mediated import in Arabidopsis.
  Xu, Journal of experimental botany 2017
  • GeneRIF: Expression of glucosinolate (GLS) importers GTR1 and GTR2 inside the stele, along with earlier observations, suggest three possible routes of stele-synthesized aliphatic GLS after their synthesis: (i) GTR-dependent import to cells symplastically connected to cortical cells and rhizosphere; (ii) GTR-independent transport via xylem to the shoot; and (iii) GTR-dependent import to GLS-degrading myrosin cells at the cortex.
• GTR1 is a jasmonic acid and jasmonoyl-l-isoleucine transporter in Arabidopsis thaliana.
  Ishimaru, Bioscience, biotechnology, and biochemistry 2017 (PubMed)
  • GeneRIF: GTR1 would be involved in the translocation of JA and JA-Ile in plant and may be contributed to correct positioning of JA and JA-Ile to attenuate an excessive wound response in undamaged leaves
• Dimerization of GTR1 regulates their plasma membrane localization.
  Ishimaru, Plant signaling & behavior 2017
  • GeneRIF: dimerization of GTR1, possibly induced by dephosphorylation of the Thr residue located between the possible transmembrane regions, regulates its plasma membrane localization.
• Phosphorylation at serine 52 and 635 does not alter the transport properties of glucosinolate transporter AtGTR1.
  Jørgensen, Plant signaling & behavior 2016
  • GeneRIF: Phosphorylation of AtGTR1 is not directly involved in regulating AtGTR1 transport activity.
• Upon bolting the GTR1 and GTR2 transporters mediate transport of glucosinolates to the inflorescence rather than roots.
  Andersen, Plant signaling & behavior 2014
  • GeneRIF: glucosinolate can specifically translocate from rosette and roots to inflorescence in a GTR1- and GTR2-dependent manner
• Elucidating the role of transport processes in leaf glucosinolate distribution.
  Madsen, Plant physiology 2014
  • GeneRIF: GTR1 role of transport processes in leaf glucosinolate distribution
• NRT/PTR transporters are essential for translocation of glucosinolate defence compounds to seeds.
  Nour-Eldin, Nature 2012 (PubMed)
  • GeneRIF: GTR1 and GTR2 control the loading of glucosinolates from the apoplasm into the phloem. [GTR1]

AT3G47960 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
24% identity, 88% coverage

• Arabidopsis Transcriptomics Reveals the Role of Lipoxygenase2 (AtLOX2) in Wound-Induced Responses
  Kaur, International journal of molecular sciences 2024
  • “...), MYB28 ( At5g61420 ), MYB29 ( At5g07690 ), MYB76 ( At5g07700 ), NPF2.10 ( At3g47960 ), JAL23 ( At2g39330 ), CYP79B2 ( At4g39950 ), CYP79B3 ( At2g22330 ), CYP83B1 ( At4g31500 ), UGT74B1 ( At1g24100 ), SOT16 ( At1g74100 ), CYP81F4 ( At4g37410 ), CYP81F1...”
• Membrane nanodomains and transport functions in plant
  Martinière, Plant physiology 2021
  • “...Early-responsive to dehydration (ERD) AT1G30360 (ERD4) Leaves Demir et al., 2013 Glucosinolate Glucosinolate transporter (GTR) AT3G47960 (GTR1) Suspension cell cultures Keinath et al., 2010 Lipids Aminophospholipid ATPase (ALA) AT5G44240 (ALA2) Suspension cell cultures Yoshida et al., 2013 Glycosylphosphatidylinositol-anchored lipid protein transfer (LTPG) AT1G27950 (LTPG1) Callus from...”
• An amiRNA screen uncovers redundant CBF and ERF34/35 transcription factors that differentially regulate arsenite and cadmium responses
  Xie, Plant, cell & environment 2021
  • “...ROF1 rotamase FKBP 1 2.7 0.0401 AT4G26080 ABI1 Protein phosphatase 2C family protein 2.6 0.0483 AT3G47960 GTR1 Major facilitator superfamily protein 2.5 0.0483 AT2G18690 AT2G18690 transmembrane protein 2.4 0.05 AT2G41800 AT2G41800 imidazolonepropionase (Protein of unknown function, DUF642) 2.4 0.0483 AT2G21130 AT2G21130 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family...”
• Efficient Protoplast Regeneration Protocol and CRISPR/Cas9-Mediated Editing of Glucosinolate Transporter (GTR) Genes in Rapeseed (Brassica napus L.)
  Li, Frontiers in plant science 2021
  • “...Genes, sgRNA Design and Vector Construction Two known BnGTR orthologs from A. thaliana, AtGTR1 ( AT3G47960 ) and AtGTR2 ( AT5G62680 ) were used for a BLAST query in the NCBI database against the rapeseed reference genome cv. ZS11 (Bra_napus_v2.0) and six paralogs of BnGTR1 (...”
• A cell suspension based uptake method to study high affinity glucosinolate transporters
  Nambiar, Plant methods 2020
  • “...List of primers used in this study S. no. Primer Sequence (5-3) Gene amplification 1 At3G47960 GTR1 FP CACCATGAAGAGCAGAGTCATTCTTAACC 2 At3G47960 GTR1 RP TCAGACAGAGTTCTTGTCTTGTAGC 3 At5G62680 GTR2 FP CACCATGGAGAGAAAGCCTCTTGAAC 4 At5G62680 GTR2 RP TCAGGCAACGTTCTTGTCTTGCTG Transgene insertion validation 5 Bar FP GCTCTACACCCACCTGCTGAA-3 6 Bar RP TCAGATCTCGGTGACGG-3 7...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...AtNPF2.9 NRT1.9/GTR3 At1g18880 NPF21 NO 3 [ 53 ]; 4MTB [ 20 ] AtNPF2.10 GTR1 At3g47960 NPF21 NO 3 /4MTB [ 20 ]; 8MTO [ 47 ]; GA 1/3/4 /MeJA [ 18 , 54 ] MeJA AtNPF2.11 NRT1.10/GTR2 At5g62680 NPF21 NO 3 /4MTB [ 20 ];...”
• Molecular Cloning and Characterization of Three Glucosinolate Transporter (GTR) Genes from Chinese Kale
  Jiang, Genes 2019
  • “...transporting system for glucosinolates in plants [ 9 , 10 ]. The transporter genes ATGTR1 (AT3G47960) and ATGTR2 (AT5G62680) were identified in Arabidopsis thaliana [ 5 ]. GTR transporters play an important role in the transportation of glucosinolates in plants. There was no accumulation of glucosinolate...”
  • “...gene, Bo3g113800.1, Bo1g076800.1, and Bo3g137030.1. BocGTR1a,b,c have similarities of 83%, 81%, and 85% with AtGTR1 (At3G47960), respectively. In addition, the similarity among the three BocGTR1s was 88.18%, as analyzed by Soft DNAMAN 7.0 ( Figure 1 C), which indicated that these three genes belonged to the...”
• Genetic architecture of glucosinolate variation in Brassica napus
  Kittipol, Journal of plant physiology 2019
  • “...we analyzed additional seed data for associations with the orthologues of Arabidopsis GSL transporters, GTR1 (AT3G47960) and GTR2 (AT5G62680). In B. napus genome, four orthologues of GTR1 (on C3 and A6) and five orthologues of GTR2 (on C3, C9, A6 and A9) were found but none...”
• More

M7ZN84 Nitrate transporter 1.4 from Triticum urartu
24% identity, 88% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings
  Santi, Frontiers in plant science 2017
  • “...magnesium transporter 5.44 GRMZM2G107239_T01 Q0IQZ4 Os11g0695900 protein 4.87 GRMZM2G173669_T01 B4FTL9 Sugar transporter SWEET 3.38 GRMZM2G476069_T01 M7ZN84 Nitrate transporter 1.4 3.01 GRMZM2G098088_T01 K7UTZ0 Hexose transporter 2.75 GRMZM2G384661_T01 K7WBE5 Uncharacterized protein 2.71 GRMZM2G425683_T01 B6TCP1 Carbohydrate transporter/sugar porter/transporter 2.37 GRMZM2G152555_T01 W9R1V3 Oligopeptide transporter 1 2.28 GRMZM2G092780_T01 C0P4H8 Phosphate transporter...”

PTR52_ARATH / Q3E8X3 Protein NRT1/ PTR FAMILY 2.8; AtNPF2.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G28470 transporter from Arabidopsis thaliana
24% identity, 96% coverage

• Environmental regulation of male fertility is mediated through Arabidopsis transcription factors bHLH89, 91, and 10
  Robson, Journal of experimental botany 2024
  • “...CYP98A9 4.60 3.74 AT1G75910 EXL4 8.55 6.77 AT1G75920 EXL5 4.46 4.06 AT1G75930 EXL6 7.19 4.25 AT5G28470 FST1 4.28 4.47 AT5G59845 GASA10 2.02 1.96 AT5G07530 GRP17 5.28 AT3G47870 LBD27 3.13 1.71 AT1G24400 LHT2 2.77 2.01 AT1G18280 LTPG3 5.26 2.98 AT4G08670 LTPG4 4.77 2.38 AT2G32460 MYB101 2.81 2.02...”
• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...3.85 5.14 Nitrate (NPF family) NPF2.6 At3g45660 x 3.34 x x Nitrate (NPF family) NPF2.8/NRT1.9 At5g28470 x 4.49 x x Nitrate (NPF family) NPF2.13/NRT1.7 At1g69870 x 2.48 x x Nitrate (NPF family) NPF4.1/AIT3 At3g25260 x x x 2.3 Nitrate (NPF family) NPF5.3/NRT1.8 At5g46040 x 4.1 x...”
• Global transcriptome analysis reveals potential genes associated with genic male sterility of rapeseed (Brassica napus L.)
  Jiang, Frontiers in plant science 2022
  • “...development and lipid accumulation within the tapetum. Ariizumi etal., 2010 BnaA06g29150D 7.03 3.50 / / AT5G28470 NPF2.8, FST1 The Tapetal Major Facilitator NPF2.8 is Required for Accumulation of Flavonol Glycosides on the Pollen Surface Grunewald etal., 2020 BnaC03g26220D / 1.31 1.95 2.51 AT2G29940 ABCG31 ABCG9 and...”
• Single-nucleus RNA-seq reveals that MBD5, MBD6, and SILENZIO maintain silencing in the vegetative cell of developing pollen
  Ichino, Cell reports 2022
  • “...are demethylated by DME, used in Figure 6B , includes: AT1G66235, AT2G19480, AT1G44120, AT2G16586, AT2G14260, AT5G28470, AT1G35540, AT3G30720, AT1G74800, AT2G16015, AT2G22055/RALFL15, AT2G07040/PRK2, novel_Chr1_coding_102/RKF2/AT1G19090, novel_Chr2_coding_224/PLOU/AT2G16030. Pollen transcriptome reannotation All Pollen RNA-seq libraries (27 libraries total) were filtered and trimmed as described in previous section ( analysis of...”
• The Tapetal Major Facilitator NPF2.8 Is Required for Accumulation of Flavonol Glycosides on the Pollen Surface in Arabidopsis thaliana
  Grunewald, The Plant cell 2020 (PubMed) (secret)
• A single-population GWAS identified AtMATE expression level polymorphism caused by promoter variants is associated with variation in aluminum tolerance in a local Arabidopsis population
  Nakano, Plant direct 2020
  • “...Fbox and associated interaction domainscontaining protein AT3G23430 Phosphate 1 (PHO1) 5_10425150 AT5G04755 Long noncoding RNA AT5G28470 Major facilitator superfamily protein 5_20724966 AT5G50920 CLPC homologue 1 (CLPC1) AT5G50930 Histone superfamily protein AT5G50940 RNAbinding KH domaincontaining protein AT5G50950 FUMARASE 2 (FUM2) AT5G50960 Nucleotidebinding protein 35 (NBP35) AT5G50970 Transducin...”
• In silico identification of miRNAs and their target genes and analysis of gene co-expression network in saffron (Crocus sativus L.) stigma
  Zinati, Molecular biology research communications 2016
  • “...AT5G17700 AT5G17700 MATE efflux family protein AT3G13240 AT3G13240 unknown protein AT1G11720 AT1G11720 starch synthase 3 AT5G28470 AT5G28470 Major facilitator superfamily protein AtMYB40 AT5G14340 myb domain protein 40 ERF043 AT4G32800 Integrase-type DNA-binding superfamily protein ATGLR1.3 AT5G48410 glutamate receptor 1.3 PSBI ATCG0008 photosystem II reaction center protein I...”
• Dissecting quantitative trait loci for boron efficiency across multiple environments in Brassica napus
  Zhao, PloS one 2012
  • “...in Arabidopsis , AT5G27350 and AT5G27360, function as a superfamily of monosaccharide transporters [47] . AT5G28470 functions as a major facilitating protein and is associated with pollen tube growth and development [48] . AtNIP5;1 is a B transport channel protein [13] . 10.1371/journal.pone.0045215.t007 Table 7 Candidate...”
  • “...transport; AT5G27350 solute:solute exchange; small-molecule carrier or transporter; cellular component. Bra020609 24233008 24236011 cellular component; AT5G28470 AT1G08930 oligopeptide transport; small-molecule carrier or transporter. Bra033181 17297210 17300039 small-molecule carrier or transporter AtNIP5;1 AtNIP5;1 In order to identify whether the homologous genes in B. napus localized to the...”
• More

GRMZM2G001764 uncharacterized protein LOC100191837 from Zea mays
24% identity, 90% coverage

• Genome-wide association studies in tropical maize germplasm reveal novel and known genomic regions for resistance to Northern corn leaf blight
  Rashid, Scientific reports 2020
  • “...F Phytophthora sojae growth and development 66 , 67 S1_233446021 1 5.9810 06 C 6.368 GRMZM2G001764 Protein NRT1/ PTR FAMILY 5.2 Arabidopsis 94 S8_131534569 8 7.9510 06 G 6.204 GRMZM2G351921 S1_161617710 1 8.2810 06 C 6.18 GRMZM2G060690 Cyclin-A2 Alfalfa Meristem formation cell division and cell morphogenesis...”

LOC4330372 protein NRT1/ PTR FAMILY 7.2 from Oryza sativa Japonica Group
24% identity, 90% coverage

• Functional analysis of the OsNPF4.5 nitrate transporter reveals a conserved mycorrhizal pathway of nitrogen acquisition in plants
  Wang, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...OsPT11 (LOC4324187), OsHA1 (LOC4331281), OsNAR2.1 (LOC4329861), OsNRT2.1 (LOC4328051), OsNRT2.2 (LOC4328052), OsNPF1.3 (LOC4327022), OsNPF5.4 (LOC4348864), OsNPF7.2 (LOC4330372), OsNPF8.3 (LOC4336852), OsAMT3.1 (LOC107276856), OsNR1 (LOC4330867), OsNR2 (LOC4345798), OsGS1.1 (LOC4330649), MtNPF4.5 (LOC11406786), ZmNPF4.5 (LOC103652484), and SbNPF4.5 (LOC8062188). Supplementary Material Supplementary File Supplementary File This work was supported by National Key...”

LOC4324322 protein NRT1/ PTR FAMILY 2.13 from Oryza sativa Japonica Group
23% identity, 92% coverage

• Physico-chemical characterization and transcriptome analysis of 5-methyltryptophan resistant lines in rice
  Nogoy, PloS one 2019
  • “...10 up LOC_Os03g15540 transfer/carrier protein, transporter 10 up LOC_Os01g68510 transporter protein NRT1/ PTR FAMILY 2.13 (LOC4324322) 5 up LOC_Os04g30740 transporter uncharacterized LOC4335608 (LOC4335608) 10 up LOC_Os05g01560 ATP synthase, hydrolase V-type proton ATPase 16 kDa proteolipid subunit (LOC4337563) 20 down LOC_Os03g11010 cation transporter metal transporter Nramp2 (LOC4332012)...”

PTR33_ARATH / Q9LVE0 Protein NRT1/ PTR FAMILY 6.4; AtNPF6.4; Nitrate transporter 1.3 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT3G21670 nitrate transporter (NTP3) from Arabidopsis thaliana
25% identity, 90% coverage

• function: Low-affinity nitrate transporter.
• Functional and Molecular Characterization of Plant Nitrate Transporters Belonging to NPF (NRT1/PTR) 6 Subfamily
  Nedelyaeva, International journal of molecular sciences 2024
  • “...TYIF Low-affinity nitrate transporter, nitrate deposition in the leaf petiole [ 51 ] AtNPF6.4 (NRT1.3), AT3G21670 Met103/Tyr352/Thr356/Phe502 MYTF Nitrate transport? [ 52 , 53 ] Medicago truncatula MtNPF6.5 (NRT1.1A), Medtr4g101380, plasma membrane A Thr101/Tyr356/Thr360/Phe515 TYTF Nitrate and chloride transport, Cl-selective; chloride uptake by root cells [...”
• Oligo-Carrageenan Kappa Increases Expression of Genes Encoding Proteins Involved in Photosynthesis, C, N, and S Assimilation, and Growth in Arabidopsis thaliana
  Méndez, International journal of molecular sciences 2023
  • “...AT1G66200 GLN1-2 1.8 AT5G35630 GLN2 1.6 AT1G52190 NPF1.2 1.3 AT2G26690 NPF6.2 2.8 AT1G12110 NPF6.3 2.5 AT3G21670 NPF6.4 5.9 AT2G15620 NIR1 1.4 Sulfur uptake AT1G62180 APR2 2.9 AT4G21990 APR3 1.8 AT5G67520 APK4 3.4 AT2G43750 OASB 1.6 AT5G28030 DES1 1.9 AT5G28020 CYSD2 3.2 AT2G25680 SULTR2 2.5 AT3G51895 SULTR3...”
• Comparative transcriptome analysis reveals the phosphate starvation alleviation mechanism of phosphate accumulating Pseudomonas putida in Arabidopsis thaliana
  Srivastava, Scientific reports 2023
  • “...viz. nitrate transporter 2.2 ( NRT2.2 ; At1g08100 ), NRT2.5 ( At1g12940 ), NRT1 ( At3g21670 ), glutamate dehydrogenase 3 ( GDH3 ; At3g03910 ) and glutamine synthetase 1;4 ( GLN1 ;4; At5g16570 ) was upregulated in HA and HA+RAR treatment. Phosphate stress responsive genes such...”
• Plant nitrogen availability and crosstalk with phytohormones signallings and their biotechnology breeding application in crops
  Xing, Plant biotechnology journal 2023
  • “....( 2016 ); Kanno etal .( 2012 ) AtNPF4.2 At3g25280 AtNPF4.5 At1g27040 AtNPF4.6 At1g69850 AtNRT1.3 At3g21670 NO 3 transporters; N uptake and transport; regulated by CTK O'Brien etal .( 2016 ); Fan etal .( 2009 ); Wang etal .( 2012 ) AtNRT1.4 At2g26690 AtNRT1.7 At1g69870 AtNRT2.7...”
• A single-cell Arabidopsis root atlas reveals developmental trajectories in wild-type and cell identity mutants
  Shahan, Developmental cell 2022
  • “...JKD ), a ground tissue marker, as well as cortex-specific markers CORTEX (AT1G09750) and NPF6.4 (AT3G21670) also match the expected profiles. Examples of newly identified genes with expression profiles specific to a subset of the developmental progression are shown for cortex ( Fig. 3F ). Differential...”
• A combinatorial indexing strategy for low-cost epigenomic profiling of plant single cells
  Tu, Plant communications 2022
  • “...in our data. Gene body chromatin accessibility for NITRATE PEPTIDE TRANSPORTER 6.4 ( NPF6.4 ; AT3G21670), a cortical parenchyma marker gene ( Farmer etal., 2021 ), was enriched in predicted cortex clusters (clusters 12 and 13). The SCARECROW ( SCR ; AT3G54220) gene, which encodes a...”
• Molecular mechanisms of resistance to Myzus persicae conferred by the peach Rm2 gene: A multi-omics view
  Le, Frontiers in plant science 2022
  • “...[glutamine-hydrolyzing] 1 Prupe_4G089000 AT4G21120 72 Yes 4.0 3.80E-33 CAT1; Cationic amino acid transporter 1 Prupe_3G211600 AT3G21670 74 Yes 1.4 3.70E-02 NPF6.4; Protein NRT1/PTR FAMILY 6.4 Prupe_1G052400 AT4G13510 80 Yes 1.8 2.10E-07 AMT1; Ammonium transporter 1 Urea cycle/Proline metabolism Prupe_1G463900 AT3G57560 70 Yes -1.6 2.00E-03 NAGK; Acetylglutamate...”
• The Expected and Unexpected Roles of Nitrate Transporters in Plant Abiotic Stress Resistance and Their Regulation
  Zhang, International journal of molecular sciences 2018
  • “...for the regulation of stomatal aperture in shoots [ 24 ] AtNPF6.4 / AtNRT1.3 / At3g21670 Arabidopsis thaliana Polyamine resistance is increased in npf6.4 mutants [ 25 ] AtNPF7.3 / AtNRT1.5 At1g32450 Arabidopsis thaliana Downregulated by cadmium, salt stress, and knockout mutants show enhanced tolerance to...”
• More
• Membrane Proteomics of Arabidopsis Glucosinolate Mutants cyp79B2/B3 and myb28/29
  Mostafa, Frontiers in plant science 2017
  • “...protein 4 RIN4 0.633 0.043 Bacterial response and immunity process D Axtell and Staskawicz, 2003 Q9LVE0 At3g21670 Protein NRT1/ PTR FAMILY 6.4 NPF6.4 0.628 0.031 Transport activity and nitrate synthesis D, H, S, T, M Okamoto et al., 2003 Q9LFS3 At5g16010 3-oxo-5-alpha-steroid 4-dehydrogenase family protein F1N13_150...”

PTR24_ARATH / Q8RX67 Protein NRT1/ PTR FAMILY 5.11; AtNPF5.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G72130 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
25% identity, 92% coverage

• Tonoplast-localized nitrate uptake transporters involved in vacuolar nitrate efflux and reallocation in Arabidopsis
  He, Scientific reports 2017
  • “...found in the Arabidopsis Genome Initiative or GenBank/EMBL databases under the following accession numbers: NPF5.11 (At1g72130), NPF5.12 (At1g72140), NPF5.16 (At1g22550), NRT1.8 (At4g21680), CHL1 (At1g12110), SAND (At2g28390), Actin2 (At3g18780). Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations. Acknowledgements...”
• QTL analysis of the developmental response to L-glutamate in Arabidopsis roots and its genotype-by-environment interactions
  Walch-Liu, Journal of experimental botany 2017
  • “...same family as the NRT1 nitrate transceptor: At1g72120 ( NRT1.15/AtNPF5.14 ), At1g72125 ( NRT1.16/AtNPF5. 13), At1g72130 ( AtNPF5.11 ), At1g72140 ( AtNPF5.12 ). The NPF family in Arabidopsis has 53 members belonging to 8 subfamilies and between them they transport a diverse range of substrates, including...”
• Nitrogen affects cluster root formation and expression of putative peptide transporters
  Paungfoo-Lonhienne, Journal of experimental botany 2009
  • “...shared the highest similarity with HaPTR12 (72% identity), Arabidopsis At1g22540 (60% identity), and At1g72140 and At1g72130 (51% identity, each). The two latter genes are expressed to a higher level in root than in shoot of Arabidopsis ( Tsay et al. , 2007 ), but substrate selectivity...”

LOC101498251 protein NRT1/ PTR FAMILY 3.1 from Cicer arietinum
22% identity, 96% coverage

• Comparative Root Transcriptomics Provide Insights into Drought Adaptation Strategies in Chickpea (Cicer arietinum L.)
  Bhaskarla, International journal of molecular sciences 2020
  • “...stress ( Figure 6 ). The dual affinity nitrate transporters NRT1 / PTR FAMILY 3.1 (LOC101498251) and NRT1 / PTR FAMILY 5.6 -like (LOC101497328) were strongly upregulated in both the genotypes at RS ( Figure 6 ). Water molecules are transported passively by aquaporin channel proteins...”

PTR14_ARATH / Q9LQL2 Protein NRT1/ PTR FAMILY 7.3; AtNPF7.3; Nitrate transporter 1.5 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
TC 2.A.17.3.19 / Q9LQL2 Nitrate transporter 1.5 from Arabidopsis thaliana (see 5 papers)
AT1G32450 NRT1.5 (NITRATE TRANSPORTER 1.5); nitrate transmembrane transporter/ transporter from Arabidopsis thaliana
NP_174523 nitrate transporter 1.5 from Arabidopsis thaliana
23% identity, 87% coverage

• function: Low-affinity proton-dependent bidirectional nitrate transporter. Involved in nitrate loading into xylem and not in nitrate uptake. Not involved in histidine or dipeptides transport.
  disruption phenotype: No visible phenotype when grown under normal conditions. Lower nitrate concentration in xylem sap. Decreased long- distance root-to-shoot transport of nitrate but not of sulfate or phosphate.
• substrates: nitrate
• Fine-Tuning of Arabidopsis thaliana Response to Endophytic Colonization by Gluconacetobacter diazotrophicus PAL5 Revealed by Transcriptomic Analysis
  Soares, Plants (Basel, Switzerland) 2024
  • “...uptake (nitrogen sources) and transport systems were identified in shoots and roots. The NRT1.5 gene (at1g32450), a member of the NRT1 family that encodes the low-affinity transport system (LAT), was induced in both shoot and root tissues. Shoots and roots also showed the induction of genes...”
• Overexpression of SLIM1 transcription factor accelerates vegetative development in Arabidopsis thaliana
  Apodiakou, Frontiers in plant science 2024
  • “...3 content in 35S::SLIM1 is only 5% of the levels at 30 DAS. Additionally, NRT1;5 (AT1G32450), an important long-distance root-to-shoot transporter ( Chen etal., 2021 ), and NRT1;7 (AT1G69870), a source-to-sink transporter ( Fan etal., 2009 ), are induced in 35S::SLIM1 at 44 DAS relative to...”
• The K⁺ transporter NPF7.3/NRT1.5 and the proton pump AHA2 contribute to K⁺ transport in Arabidopsis thaliana under K⁺ and NO₃^- deficiency
  Sena, Frontiers in plant science 2023
  • “...QIAfilter Plasmid Mega Kit (Qiagen). The Cub-NRT1.5 bait vector was constructed by amplifying the NRT1.5 (At1g32450) full-length coding sequence (CDS) including the stop codon on plasmid pcAcNRT1.5-9 ( Drechsler etal., 2015 ) with Phusion High-Fidelity DNA Polymerase (ThermoFisher Scientific) and inserting it into PstI-SacII-digested pBT3-N plasmid...”
• Dynamic transcriptome analysis unravels key regulatory genes of maize root growth and development in response to potassium deficiency
  Guo, Planta 2023
  • “...2.7 AT4G18290 KAT2 POTASSIUM CHANNEL PROTEIN (Hong et al. 2013 ) Zm00001d017666 1.3 1.1 1.1 AT1G32450 NRT1.5 NITRATE TRANSPORTER 1.5 (Hong et al. 2013 ) Zm00001d018918 1.8 AT4G32500 AKT5 K+TRANSPORTER 5 (Pilot et al. 2003 ) Zm00001d031923 AT5G51710 KEA K+EFFLUX ANTIPORTER (Ahn et al. 2004 )...”
• ARR17 controls dioecy in Populus by repressing B-class MADS-box gene expression
  Leite, Philosophical transactions of the Royal Society of London. Series B, Biological sciences 2022
  • “...(ZP1) Potra2n18c32253 1.63 0.04113 Potri.018G113300 AT4G02050 sugar transporter protein 7 (STP7) Potra2n14c27869 1.54 0.041274 Potri.014G179400 AT1G32450 nitrate transporter 1.5 (NRT1.5) Figure 2 . PISTILLATA ( PI ) and UNUSUAL FLORAL ORGANS ( UFO ) are strongly upregulated in arr17 CRISPR mutants on day 20. Volcano plot...”
• Regulation of Nitrate (NO₃) Transporters and Glutamate Synthase-Encoding Genes under Drought Stress in Arabidopsis: The Regulatory Role of AtbZIP62 Transcription Factor
  Rolly, Plants (Basel, Switzerland) 2021
  • “...in response to drought stress (about a 94.2-fold change) in Col-0. Table 2 identified NRT1.5 (AT1G32450) and NRT1.7 (AT1G69870) as potential targets for AtNRT2.2 during NO 3 transport. Meanwhile, the expression of AtNRT2.1 showed a similar transcript accumulation pattern with Col-0 WT ( Figure 3 C),...”
  • “...seed germination. The uptake activity is not required for sensor function. [ 31 ] NRT1.5 AT1G32450 Protein NRT1/PTR FAMILY 7.3; Transmembrane nitrate transporter. Involved in xylem transport of nitrate from root to shoot. Induced in response to nitrate. Not involved in nitrate uptake. Belongs to the...”
• Differences in mineral accumulation and gene expression profiles between two metal hyperaccumulators, Noccaea japonica and Noccaea caerulescens ecotype Ganges, under excess nickel condition
  Enomoto, Plant signaling & behavior 2021 (secret)
• The Loss of Function of the NODULE INCEPTION-Like PROTEIN 7 Enhances Salt Stress Tolerance in Arabidopsis Seedlings
  Le, Frontiers in plant science 2021
  • “...), RD29A ( AT5G52310 ), NIA1 ( AT1G77760 ), NIA2 ( AT1G37130 ), NRT1.5 ( AT1G32450 ), NRT1.8 ( AT4G21680 ), NCED3 ( AT3G14440 ), BG1 ( AT3G57270 ), and BG2 ( AT3G57260 ), ACTIN2 ( AT3G18780 ). Statistical Analyses To obtain reliable results, each experiment...”
• More
• Nitrogen form-mediated ethylene signal regulates root-to-shoot K+ translocation via NRT1.5.
  Chen, Plant, cell & environment 2021 (PubMed)
  • GeneRIF: Nitrogen form-mediated ethylene signal regulates root-to-shoot K(+) translocation via NRT1.5.
• The Arabidopsis NRT1/PTR FAMILY protein NPF7.3/NRT1.5 is an indole-3-butyric acid transporter involved in root gravitropism.
  Watanabe, Proceedings of the National Academy of Sciences of the United States of America 2020
  • GeneRIF: The Arabidopsis NRT1/PTR FAMILY protein NPF7.3/NRT1.5 is an indole-3-butyric acid transporter involved in root gravitropism.
• Nitrate transporter NPF7.3/NRT1.5 plays an essential role in regulating phosphate deficiency responses in Arabidopsis.
  Cui, Biochemical and biophysical research communications 2019 (PubMed)
  • GeneRIF: The NPF7.3/NRT1.5 is an important component in the regulation of phosphate deficiency responses in Arabidopsis.
• The Transcription Factor MYB59 Regulates K+/NO3 - Translocation in the Arabidopsis Response to Low K+ Stress.
  Du, The Plant cell 2019
  • GeneRIF: These data demonstrate that MYB59 responds to low K(+) (LK) stress and directs root-to-shoot K(+)/NO3 (-) transport by regulating the expression of NPF7.3 in Arabidopsis roots.
• NRT1.5/NPF7.3 Functions as a Proton-Coupled H+/K+ Antiporter for K+ Loading into the Xylem in Arabidopsis.
  Li, The Plant cell 2017
  • GeneRIF: This study reveals that NRT1.5 plays a crucial role in K(+) translocation from root to shoot and is also involved in the coordination of potassium/nitrates distribution in plants.
• Arabidopsis NRT1.5 Mediates the Suppression of Nitrate Starvation-Induced Leaf Senescence by Modulating Foliar Potassium Level.
  Meng, Molecular plant 2016 (PubMed)
  • GeneRIF: NRT1.5 likely perceives nitrate starvation-derived signals to prevent leaf senescence by facilitating foliar potassium accumulation
• The Arabidopsis nitrate transporter NPF7.3/NRT1.5 is involved in lateral root development under potassium deprivation.
  Zheng, Plant signaling & behavior 2016
  • GeneRIF: a possible involvement of NPF7.3/NRT1.5 in auxin homeostasis in roots under potassium deprivation, is reported.
• Nitrate-Dependent Control of Shoot K Homeostasis by the Nitrate Transporter1/Peptide Transporter Family Member NPF7.3/NRT1.5 and the Stelar K+ Outward Rectifier SKOR in Arabidopsis.
  Drechsler, Plant physiology 2015
  • GeneRIF: Data show that nutritional conditions as a critical factor for the joint activity of Arabidopsis proteins SKOR and NPF7.3/NRT1.5 for shoot potassium (K) homeostasis.
• More

PTR21_ARATH / Q8RX77 Protein NRT1/ PTR FAMILY 2.13; AtNPF2.13; Nitrate transporter 1.7 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
TC 2.A.17.3.15 / Q8RX77 Nitrate transporter 1.7 from Arabidopsis thaliana (see 7 papers)
NP_564979 nitrate transporter 1.7 from Arabidopsis thaliana
AT1G69870 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
26% identity, 90% coverage

• function: Low-affinity proton-dependent nitrate transporter. Not involved in dipeptides transport, but has a weak glucosinolate transport activity. Involved in phloem loading and nitrate remobilization from the older leaves to other tissues.
  subunit: Interacts with NLA.
  disruption phenotype: No visible phenotype when grown under normal conditions. Growth retardation when starved of nitrogen.
• substrates: nitrate
• Nitrogen Limitation Adaptation (NLA) is involved in source-to-sink remobilization of nitrate by mediating the degradation of NRT1.7 in Arabidopsis.
  Liu, The New phytologist 2017 (PubMed)
  • GeneRIF: NLA interacts with NRT1.7 in the plasma membrane.
• The Arabidopsis nitrate transporter NRT1.7, expressed in phloem, is responsible for source-to-sink remobilization of nitrate.
  Fan, The Plant cell 2009
  • GeneRIF: NRT1.7 encodes a low-affinity nitrate transporter, and is involved in nitrate remobilization from source to sink tissues mediated by phloem transport. [NRT1.7]
• The AP2/ERF Transcription Factor ERF56 Negatively Regulating Nitrate-Dependent Plant Growth in <i>Arabidopsis</i>
  Yao, International journal of molecular sciences 2025
  • “...transport under the condition of nitrogen starvation [ 23 ]. The mRNA of NRT1.7 ( AT1G69870 ), NRT2.7 ( AT5G14570 ), and CEPR2 ( AT1G72180 ) were up-regulated by the overexpression of ERF56 . NRT1.7 encodes a nitrate transporter responsible for the remobilization of nitrate from...”
• Overexpression of SLIM1 transcription factor accelerates vegetative development in Arabidopsis thaliana
  Apodiakou, Frontiers in plant science 2024
  • “...Additionally, NRT1;5 (AT1G32450), an important long-distance root-to-shoot transporter ( Chen etal., 2021 ), and NRT1;7 (AT1G69870), a source-to-sink transporter ( Fan etal., 2009 ), are induced in 35S::SLIM1 at 44 DAS relative to Col-0 ( Figure4B ). The chloride channel CLC-A (AT5G40890) has a main role...”
• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...x x Nitrate (NPF family) NPF2.8/NRT1.9 At5g28470 x 4.49 x x Nitrate (NPF family) NPF2.13/NRT1.7 At1g69870 x 2.48 x x Nitrate (NPF family) NPF4.1/AIT3 At3g25260 x x x 2.3 Nitrate (NPF family) NPF5.3/NRT1.8 At5g46040 x 4.1 x x Nitrate (NPF family) NPF5.6 At2g37900 x x 3.57...”
• Gibberellin and abscisic acid transporters facilitate endodermal suberin formation in Arabidopsis
  Binenbaum, Nature plants 2023
  • “...membrane-localized GA and ABA importers NPF2.12 ( AT1G27080 ) and its close paralog NPF2.13 ( AT1G69870 ) form a phylogenetic sub-clade with NPF2.14 ( Fig. 3a , Sup. Fig. 8 ). We hypothesized that due to this proximity on the phylogenetic tree, NPF2.12 and NPF2.13 might...”
• Plant nitrogen availability and crosstalk with phytohormones signallings and their biotechnology breeding application in crops
  Xing, Plant biotechnology journal 2023
  • “...2016 ); Fan etal .( 2009 ); Wang etal .( 2012 ) AtNRT1.4 At2g26690 AtNRT1.7 At1g69870 AtNRT2.7 At3g45650 AtNRT2.1 At1g08090 NO 3 transporters; N uptake and transport; regulated by CTK and ETH O'Brien etal .( 2016 ); Fan etal .( 2009 ); Wang etal .( 2012...”
• Transcriptome and Small RNA Sequencing Reveal the Mechanisms Regulating Harvest Index in Brassica napus
  Zhang, Frontiers in plant science 2022
  • “...Yang et al., 2017 ) and AtNPF6.2 (At2g26690) ( Tong et al., 2016 ); AtNRT1.7/NPF2.13 (At1g69870) also plays important roles in source-to-sink remobilization of nitrate in Arabidopsis ( Fan et al., 2009 ; Liu et al., 2017 ). PMT5 can transport a wide range of linear...”
• The Circadian Clock Gene Circuit Controls Protein and Phosphoprotein Rhythms in Arabidopsis thaliana
  Krahmer, Molecular & cellular proteomics : MCP 2022
  • “...24 40 AT5G48250 BBX8 11033 16261 SGEAYDYDPMSPT RSY 15/16 7.4E-03 1.6E-06 4.0E-02 1.6E-04 24 40 AT1G69870 NRT1.7 7142 8476 ISSPGSILDAEK 3 1.7E-04 3.0E-06 6.8E-03 2.8E-04 24 48 AT5G40890 CLC-A 1783 1852 HRTLSSTPLALVGAK 3, 5 5.1E-05 1.1E-04 4.0E-03 7.3E-03 24 24 AT5G53420 CCT101. 1950 1997 LGAGLVQSPLDR 8...”
• Regulation of Nitrate (NO₃) Transporters and Glutamate Synthase-Encoding Genes under Drought Stress in Arabidopsis: The Regulatory Role of AtbZIP62 Transcription Factor
  Rolly, Plants (Basel, Switzerland) 2021
  • “...drought stress (about a 94.2-fold change) in Col-0. Table 2 identified NRT1.5 (AT1G32450) and NRT1.7 (AT1G69870) as potential targets for AtNRT2.2 during NO 3 transport. Meanwhile, the expression of AtNRT2.1 showed a similar transcript accumulation pattern with Col-0 WT ( Figure 3 C), which may imply...”
  • “...cellular ABA uptake. Belongs to the PTR2/POT transporter (TC 2.A.17) family [ 32 ] NRT1.7 AT1G69870 Protein NRT1/PTR family 2.13; Low-affinity proton-dependent nitrate transporter. Involved in phloem loading and nitrate remobilization from the older leaves to other tissues; Belongs to the PTR2/POT transporter (TC 2.A.17) family...”
• More

GRMZM2G148800 uncharacterized protein LOC100383726 from Zea mays
23% identity, 96% coverage

• Comparative Transcriptome Analysis of Iron and Zinc Deficiency in Maize (Zea mays L.)
  Mallikarjuna, Plants (Basel, Switzerland) 2020
  • “...Oligopeptide transporter family proteins can transport minerals in the form of metalNA complexes. OPT ( GRMZM2G148800 ) showed an upregulated expression response to Fe deficiency (Fe, FeZn) in the root. However, the downregulation was observed in the shoot under Zn deficiency (Zn, FeZn). The accumulation of...”
  • “...( GRMZM2G128995), ABC TRANSPORTER C FAMILY MEMBER 14 ( GRMZM2G142870 ), OLIGOPEPTIDE TRANSMEMBRANE TRANSPORTER ( GRMZM2G148800 ), FERRIC-CHELATE REDUCTASE ( GRMZM2G157263 ), VACUOLAR PROTON PUMP 3 ( GRMZM2G421857 ) and MITOCHONDRIAL PHOSPHATE TRANSPORTER ( GRMZM2G015401 ). Many of the ERFs are known to acts as repressor...”

LOC18047776 protein NRT1/ PTR FAMILY 2.9 from Citrus x clementina
23% identity, 88% coverage

• Comparative transcriptomic analyses of citrus cold-resistant vs. sensitive rootstocks might suggest a relevant role of ABA signaling in triggering cold scion adaption
  Primo-Capella, BMC plant biology 2022
  • “...for ABA transporters belonging to the NRT1/ PTR and ABC G families, NRT1 (LOC18047775), NRT2 (LOC18047776), NRT3 (LOC18032684), NRT4 (LOC18031923O), ABCG40 (LOC18035930, LOC18036075), were up-regulated in the 15-day samples, except ABCG22 (LOC18038312), which was clearly down-regulated in the MAC samples and its expression levels remained high...”

LOC100259122 protein NRT1/ PTR FAMILY 6.3 from Vitis vinifera
25% identity, 78% coverage

• Coastal Wild Grapevine Accession (Vitis vinifera L. ssp. sylvestris) Shows Distinct Late and Early Transcriptome Changes under Salt Stress in Comparison to Commercial Rootstock Richter 110
  Carrasco, Plants (Basel, Switzerland) 2022
  • “...d vs. 85 mM-7 d) 4.4.1. Ion Transport AS1B showed two NRT/PTR DEGs (LOC100258695 and LOC100259122) ( Figure 6 and Supplementary Data S4 ). Relative expression of LOC100258695 remains higher in Richter 110 than in AS1B across all treatments ( Supplementary Figure S1 ), while, in...”
  • “...expression of LOC100258695 in Richter 110 and AS1B genotypes. Supplementary Figure S2: Relative expression of LOC100259122 in Richter 110 and AS1B genotypes. Supplementary Figure S3: Relative expression of LOC100264818 in Richter 110 and AS1B genotypes. Supplementary Figure S4: Validation of expression profiles of salinity related genes...”

B6U0T7 Peptide transporter PTR2 from Zea mays
25% identity, 98% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
  Santi, Frontiers in plant science 2017
  • “...GRMZM2G011636_T01 A0A096PXD7 25.3 kDa vesicle transport protein 2.12 GRMZM5G850455_T01 B6T2C9 Lipid transfer protein 2.15 GRMZM2G015767_T01 B6U0T7 Peptide transporter PTR2 2.21 AC234152.1_FGT007 K7UVH5 Potassium channel2 2.28 AC203966.5_FGT006 M8CDC1 25.3 kDa vesicle transport protein 5.56 Genome ID, Maize transcript ID (ZmB73_5b_FGS_cdna.fasta.gz); FC, fold change value . Aa and...”

LOC116196913 protein NRT1/ PTR FAMILY 2.10-like from Punica granatum
24% identity, 90% coverage

• Two major chromosome evolution events with unrivaled conserved gene content in pomegranate
  Akparov, Frontiers in plant science 2023
  • “...Start End Annotation Chr1 11,265,285 LOC116195387 11,267,388 11,268,657 late embryogenesis abundant protein Lea5-like Chr2 34,332,768 LOC116196913 34,333,038 34,335,995 NRT1/PTR FAMILY 2.10-like Chr3 38,368,453 LOC116201947 38,380,754 38,382,844 3-ketoacyl-CoA synthase 12-like Chr4 16,546,459 LOC116206080 16,562,644 16,563,970 secoisolariciresinol dehydrogenase-like Chr5 11,360,872 to 11,495,723 LOC116207452 11,374,356 11,377,493 epoxide hydrolase A-like...”

H8Y6S4 ABC-type nitrate transporter (EC 7.3.2.4) from Brassica rapa subsp. chinensis (see paper)
26% identity, 89% coverage

PTR54_ARATH / Q9FM20 Protein NRT1/ PTR FAMILY 4.7; AtNPF4.7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G62730 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
22% identity, 90% coverage

• Comparative transcriptome analysis reveals significant differences in the regulation of gene expression between hydrogen cyanide- and ethylene-treated Arabidopsis thaliana
  Yu, BMC plant biology 2019
  • “...regulator 9 8.00 3.00 2.73 1.45 AT3G14200 Molecular chaperone (DnaJ superfamily) 7.89 2.98 6.87 2.78 AT5G62730 H+/oligopeptide symporter 7.89 2.98 2.51 1.33 AT5G52640 Molecular chaperone (HSP90 family) 7.52 2.91 5.28 2.40 AT2G20560 Molecular chaperone (DnaJ superfamily) 7.46 2.90 5.74 2.52 FC fold change Genes exclusively induced...”
• Photosystem II Repair and Plant Immunity: Lessons Learned from Arabidopsis Mutant Lacking the THYLAKOID LUMEN PROTEIN 18.3
  Järvi, Frontiers in plant science 2016
  • “...logFC CL Drought-repressed 4 AT1G73330 2.06 1.15 ELF4 AT2G40080 1.72 1.60 Major facilitator superfamily protein AT5G62730 1.46 1.25 Major facilitator superfamily protein AT2G16660 1.32 1.18 Monothiol glutaredoxin-S4/ROXY 13 AT4G15680 1.21 1.57 Putative glutaredoxin-C12/ROXY 5 AT2G47870 1.18 1.23 Delta-9 acyl-lipid desaturase 1 AT1G06080 1.35 1.01 HAD superfamily,...”
  • “...DESATURASE 1) and drought-repressed (DROUGHT-REPRESSED 4) proteins, acid phosphatase (AT4G29270), and two putative membrane transporters (AT5G62730, AT2G16660) showed differential expression in the tlp18.3 mutant. Interestingly, two genes encoding bHLH class phytochrome A-signaling components, LONG HYPOCOTYL IN FAR-RED 1 (HFR1; AT1G02340) and PHYTOCHROME INTERACTING FACTOR 3-LIKE 1...”
• Identification of an abscisic acid transporter by functional screening using the receptor complex as a sensor
  Kanno, Proceedings of the National Academy of Sciences of the United States of America 2012
  • “...At3g25260 (AIT3) At3g21670 At3g25280 (AIT4) At5g13400 At1g12110 At5g62730 Fig. 1. Effects of group I NRT1/PTR family on ABA-dependent interactions between...”
  • “...mutants for AIT4. We also obtained two insertion alleles for At5g62730, which is in the same clade as the four AITs in the phylogenetic tree (Figs. S1C and...”
• The bZIP Transcription Factor PERIANTHIA: A Multifunctional Hub for Meristem Control
  Maier, Frontiers in plant science 2011
  • “...undecaprenyl pyrophosphate synthetase family protein/UPP synthetase family protein) 247426_at 2.12 AT5G62570 Calmodulin-binding protein 247447_at 1.98 AT5G62730 Proton-dependent oligopeptide transport (POT) family protein 247323_at 4.02 AT5G64170 Dentin sialophosphoprotein-related 247224_at 2.00 AT5G65080 AGL68/MAF5 (MADS AFFECTING FLOWERING 5) 245537_at 3.57 No_match No_match Table 2 Genes with significantly reduced expression...”

LOC101515495 protein NRT1/ PTR FAMILY 5.4 from Cicer arietinum
23% identity, 97% coverage

• Overexpression of Chickpea Defensin Gene Confers Tolerance to Water-Deficit Stress in Arabidopsis thaliana
  Kumar, Frontiers in plant science 2019
  • “...pectinesterase/pectinesterase inhibitor 25-like protein-coding 71 LOC101489717 2.13157 101489717 Ca3 probable pectinesterase/pectinesterase inhibitor 7-like protein-coding 72 LOC101515495 1.62498 101515495 Ca7 probable peptide/nitrate transporter At3g54450-like protein-coding 73 LOC101503329 2.01431 101503329 Ca1 probable polygalacturonase-like protein-coding 74 LOC101489781 3.64932 101489781 Ca7 probable xyloglucan endotransglucosylase/hydrolase protein 23-like protein-coding 75 LOC101493216 2.41189...”

PTR27_ARATH / Q9SZY4 Protein NRT1/ PTR FAMILY 6.2; AtNPF6.2; Nitrate transporter 1.4 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
TC 2.A.17.3.18 / Q9SZY4 Nitrate transporter 1.4 from Arabidopsis thaliana (see 6 papers)
AT2G26690 nitrate transporter (NTP2) from Arabidopsis thaliana
25% identity, 94% coverage

• function: Low-affinity proton-dependent nitrate transporter. Not involved in dipeptides transport.
  disruption phenotype: Wider leaves resulting from increased cell expansion. Lower nitrate content of the petiole and midrib.
• substrates: nitrate
• Functional and Molecular Characterization of Plant Nitrate Transporters Belonging to NPF (NRT1/PTR) 6 Subfamily
  Nedelyaeva, International journal of molecular sciences 2024
  • “...the absence of nitrate [ 4 , 24 , 45 , 50 ] AtNPF6.2 (NRT1.4), AT2G26690, plasma membrane Thr98/Tyr346/Ile350/Phe498 TYIF Low-affinity nitrate transporter, nitrate deposition in the leaf petiole [ 51 ] AtNPF6.4 (NRT1.3), AT3G21670 Met103/Tyr352/Thr356/Phe502 MYTF Nitrate transport? [ 52 , 53 ] Medicago truncatula...”
• Brassica rapa Nitrate Transporter 2 (BrNRT2) Family Genes, Identification, and Their Potential Functions in Abiotic Stress Tolerance
  Lv, Genes 2023
  • “...also suggest that the BrNRT2.3 homolog AtNRT2.7 might interact with AtNRT1.1, AtNRT1.5, AtNRT1.6, AtNRT1.7, and AT2G26690. AtNRT1.1 ( CHL1 ) can regulate stomatal opening; a previous study showed that chl1 mutant plants are drought tolerant because of their ability to reduce water loss [ 50 ]....”
  • “...extensive physiological adjustments, which ultimately enhances their stress tolerance [ 51 ]. AtNRT1.6, AtNRT1.7, and AT2G26690 all belong to the PTR2/POT transporter family, and PTR2 in A. thaliana is negatively regulated by ABI4 and promotes water uptake during early seed germination [ 52 ]. Similarly, BrNRT2.3...”
• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...x x Nitrate (NPF family) NPF5.14/NRT1.15 At1g72120 x 1.83 x x Nitrate (NPF family) NPF6.2/NRT1.4 At2g26690 x x 2.11 1.61 Ammonium (AMT family) AMT13 At3g24300 x 2.42 x X Ammonium (AMT family) AMT14 At4g28700 x x x 2.51 Ammonium (AMT family) AMT15 At3g24290 x 4.18 4.12...”
• Oligo-Carrageenan Kappa Increases Expression of Genes Encoding Proteins Involved in Photosynthesis, C, N, and S Assimilation, and Growth in Arabidopsis thaliana
  Méndez, International journal of molecular sciences 2023
  • “...4.1 Nitrogen assimilation AT5G56860 GATA21 1.1 AT1G66200 GLN1-2 1.8 AT5G35630 GLN2 1.6 AT1G52190 NPF1.2 1.3 AT2G26690 NPF6.2 2.8 AT1G12110 NPF6.3 2.5 AT3G21670 NPF6.4 5.9 AT2G15620 NIR1 1.4 Sulfur uptake AT1G62180 APR2 2.9 AT4G21990 APR3 1.8 AT5G67520 APK4 3.4 AT2G43750 OASB 1.6 AT5G28030 DES1 1.9 AT5G28020 CYSD2...”
• Plant nitrogen availability and crosstalk with phytohormones signallings and their biotechnology breeding application in crops
  Xing, Plant biotechnology journal 2023
  • “...etal .( 2016 ); Fan etal .( 2009 ); Wang etal .( 2012 ) AtNRT1.4 At2g26690 AtNRT1.7 At1g69870 AtNRT2.7 At3g45650 AtNRT2.1 At1g08090 NO 3 transporters; N uptake and transport; regulated by CTK and ETH O'Brien etal .( 2016 ); Fan etal .( 2009 ); Wang etal...”
• Comparative Transcriptome Analysis Reveals Common and Developmental Stage-Specific Genes That Respond to Low Nitrogen in Maize Leaves
  Guo, Plants (Basel, Switzerland) 2022
  • “...to N Zm00001d012231 ZmAAP8 AT1G10010 AAP8 amino acid permease 8 4.3 4.3 3.3 Zm00001d044529 ZmNPF6.2 AT2G26690 NPF6.2 NRT1/ PTR family 6.2 6.8 8.4 8.3 Zm00001d042684 ZmNPF5.16 AT1G22550 NPF5.16 NRT1/ PTR family 5.16 6.1 8.4 8.3 Zm00001d051525 ZmOPT4 AT5G64410 OPT4 oligopeptide transporter 4 1.8 2.3 2.7 Zm00001d045519...”
• Transcriptome and Small RNA Sequencing Reveal the Mechanisms Regulating Harvest Index in Brassica napus
  Zhang, Frontiers in plant science 2022
  • “...TRANSPORTER (NPF) family, such as AtNPF3.1 (At1g68570) ( Yang et al., 2017 ) and AtNPF6.2 (At2g26690) ( Tong et al., 2016 ); AtNRT1.7/NPF2.13 (At1g69870) also plays important roles in source-to-sink remobilization of nitrate in Arabidopsis ( Fan et al., 2009 ; Liu et al., 2017 )....”
• The Phytotoxin Myrigalone A Triggers a Phased Detoxification Programme and Inhibits Lepidium sativum Seed Germination via Multiple Mechanisms including Interference with Auxin Homeostasis
  Nakabayashi, International journal of molecular sciences 2022
  • “...(JA) n.a. n.a. n.a. UP - - UP - - UP - - UP - AT2G26690 NPF6.2 (GA) 1.0 4.9 UP - - DN - DN - - - - DN DN AT1G12110 NPF6.3 (GA) 1.0 3.2 UP DN - - DN - - - -...”
• More

LOC105168767 protein NRT1/ PTR FAMILY 4.6-like from Sesamum indicum
24% identity, 92% coverage

• Transcriptome Analysis of Sesame (Sesamum indicum L.) Reveals the LncRNA and mRNA Regulatory Network Responding to Low Nitrogen Stress
  Zhang, International journal of molecular sciences 2024
  • “...Among them, DELs MSTRG.17494.1 targets three plant NRT1/PTR family members NPF2.11(LOC105168760), NPF2.10 (LOC105168762) and NPF4.6 (LOC105168767), a previously study has proved that the NRT/NPF protein play vital roles in moving substrates including amino acids, peptides, nitrate, dicarboxylates, glucosinolates, ABA, IAA, JA and so on [ 34...”
  • “...genes related to low nitrogen tolerance. Subsequently, we will select key genes, such as NPF4.6 (LOC105168767), MYB54 (LOC105157332), PAL (LOC105161317) and so on to verify gene function and participate in the molecular mechanism of nitrogen response, which can provide genetic resources for low nitrogen tolerance breeding....”

TC 2.A.17.3.3 / Q43390 Nitrate (chlorate) or histidine:H+ symporter from Brassica napus (Rape) (see paper)
25% identity, 89% coverage

• substrates: H+, Histidine, nitrate
• Identification of RNA helicase A as a cellular factor that interacts with influenza A virus NS1 protein and its role in the virus life cycle.
  Lin, Journal of virology 2012 (no snippet)

GRMZM2G361652 uncharacterized protein LOC100191990 from Zea mays
23% identity, 88% coverage

• QTL Mapping by Whole Genome Re-sequencing and Analysis of Candidate Genes for Nitrogen Use Efficiency in Rice
  Yang, Frontiers in plant science 2017
  • “...NPF transporters (Pike et al., 2014 ). Phylogenetic analysis in graminaceous crops revealed that both GRMZM2G361652 and Sb10g009530 shared 86.2 and 86.4% similarity in amino acid sequences with LOC_Os06g15370 , respectively. The GRMZM2G361652 (PTHR11654:SF178, http://www.pantherdb.org/ ) in maize putatively encodes nitrite transporter, while Sb10g009530 (PTHR11654:SF178, http://www.pantherdb.org/...”
  • “...to those of Os06g15370 and AT1G68570 . Phylogenetic analysis in graminaceous crops revealed that both GRMZM2G361652 and Sb10g009530 shared high similarity in amino acid sequences with LOC_Os06g15370 , which is a NRT1/PTR FAMILY 3.1 gene ( https://phytozome.jgi.doe.gov/pz/portal.html ). In rice, three PTR genes have been functionally...”

LOC115709842 protein NRT1/ PTR FAMILY 2.9 from Cannabis sativa
24% identity, 90% coverage

• Sink strength, nutrient allocation, cannabinoid yield, and associated transcript profiles vary in two drug-type Cannabis chemovars
  Jost, Journal of experimental botany 2025
  • “...plant ( Fig. 9A ; Supplementary Table S7 ). Out of 18 genes, three (LOC115716024, LOC115709842, LOC115700848) showed higher expression in the stems of the THC- over the CBD-dominant chemovar suggesting a role in long-distance nitrate transport. Our sequence analysis indicated that LOC115709842 is a homologue...”

LOC112006249 protein NRT1/ PTR FAMILY 4.6 from Quercus suber
24% identity, 93% coverage

• Transcriptomic and physiological responses of Quercus acutissima and Quercus palustris to drought stress and rewatering
  Kim, Frontiers in plant science 2024
  • “...(LOC112026165), E3 ubiquitin-protein ligase RHA2B-like (LOC112033407), peroxidase 4-like (LOC112040198), protein NRT1/PTR FAMILY 4.6-like isoform X1 (LOC112006249), phylloplanin-like (LOC112013165), probable sulfate transporter 3.4 (LOC112012045), serine/threonine-protein kinase phg2-like isoform X1 (LOC112012913), putative receptor-like protein kinase At4g00960 (LOC111986751), Not Available (LOC112022298), Not Available (LOC112033153), flowering-promoting factor 1-like protein 2...”

PTR32_ARATH / Q8LPL2 Protein NRT1/ PTR FAMILY 1.1; AtNPF1.1; Nitrate transporter 1.12 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
NP_188239 Major facilitator superfamily protein from Arabidopsis thaliana
AT3G16180 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
23% identity, 95% coverage

• function: Low-affinity nitrate transporter involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves. Not involved in dipeptides transport.
  disruption phenotype: Nrt1.11 and nrt1.12 double mutant is defective in high-nitrate-enhanced growth.
• Two phloem nitrate transporters, NRT1.11 and NRT1.12, are important for redistributing xylem-borne nitrate to enhance plant growth.
  Hsu, Plant physiology 2013
  • GeneRIF: NRT1.11 and NRT1.12 are involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves, and such nitrate redistribution is a critical step for optimal plant growth enhanced by increasing external nitrate.[NRT1.12]
• Integrated analyses of ionomics, phytohormone profiles, transcriptomics, and metabolomics reveal a pivotal role of carbon-nano sol in promoting the growth of tobacco plants
  Wang, BMC plant biology 2024
  • “...associated with more than one orthologous copy in N. tabacum . For example, AtNPF1.1 ( AT3G16180 ) showed a syntenic relationship with NtNPF1.13 , NtNPF1.14 , and NtNPF1.16 (Table S3). The plantCARE database was used to search for CREs in the 2,000bp upstream promoter region sequences...”
• Orphan Genes in Crop Improvement: Enhancing Potato Tuber Protein without Impacting Yield
  Tanvir, Plants (Basel, Switzerland) 2022
  • “...St homolog PGSC0003DMG400031742), NLP7 (NIN-like protein 7, AT4G24020, St homolog PGSC0003DMG402012256), NRT1 (Nitrate transporter 1, AT3G16180, St homolog PGSC0003DMG400031742), and FLOWERING LOCUS T (FT, AT1G65480, St homolog PGSC0003DMG400023365) have a very low or no expression (~0-5 FPKM) in potato tubers compared to StNF-YC4 (~70 FPKM) despite...”
• Molecular Regulatory Networks for Improving Nitrogen Use Efficiency in Rice
  Hou, International journal of molecular sciences 2021
  • “...3 transporter redistributing xylem-borne NO 3 to enhance plant growth Transport [ 53 ] AtNRT1.12 AT3G16180 Arabidopsis Phloem-specific NO 3 transporter redistributing xylem-borne NO 3 to enhance plant growth Transport [ 53 ] AtNPF2.3 AT3G45680 Arabidopsis NO 3 excretion transporter and contribution to NO 3 translocation...”
• A population based expression atlas provides insights into disease resistance and other physiological traits in cassava (Manihot esculenta Crantz)
  Ogbonna, Scientific reports 2021
  • “...13 Manes.03G143200.v6.1 AT3G13220 ABC transporter G family member 26 ATP-binding cassette (ABC) transporter 14 Manes.16G113300.v6.1 AT3G16180 Protein NRT1/ PTR FAMILY 1.1 Transporter 15 Manes.16G007900.v6.1 AT3G21690 Protein DETOXIFICATION 40 Transporter 16 Manes.15G183200.v6.1 AT3G28007 Bidirectional sugar transporter SWEET4 17 Manes.07G111500.v6.1 AT4G01470 Aquaporin TIP1-3 18 Manes.02G006600.v6.1 AT4G10850 Bidirectional sugar...”
• The Arabidopsis RLCK VI_A2 Kinase Controls Seedling and Plant Growth in Parallel with Gibberellin
  Valkai, International journal of molecular sciences 2020
  • “...FAMILY) Gibberellin Transporters ** AT1G52190 AT1G52190 Major facilitator superfamily protein, NPF1.2 a,b 1.60 0.001941 yes AT3G16180 AT3G16180 Major facilitator superfamily protein, NPF 1.1 a 1.79 0.001941 yes AT5G46050 PTR3 peptide transporter 3, NPF 5.2 a 0.55 0.001941 yes AT5G62680 GTR2 Major facilitator superfamily protein, NPF 2.11...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...proteins Species Name Other Name Gene ID Subfamily Substrates Regulation by hormone Arabidopsis AtNPF1.1 NRT1.12 At3g16180 NPF1 NO 3 [ 10 ]; ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF1.2 NRT1.11 At1g52190 NPF1 NO 3 [ 10 ]; GA 1/3/4 /MeJA [ 18 , 50 ] AtNPF2.3...”
• Lateral Transport of Organic and Inorganic Solutes
  Aubry, Plants (Basel, Switzerland) 2019
  • “...transporter Leaf Phloem companion cells Promoter GUS and GFP fusion protein At/[ 132 ] NRT1.12/NPF1.1 At3g16180 Nitrate transporter Leaf Phloem companion cells Promoter GUS and GFP fusion protein At/[ 132 ] At: Arabidopsis thaliana ; Bv: Beta vulgaris ; Dc: Daucus carota ; Gm: Glycine max...”
• Nitrate Uptake Affects Cell Wall Synthesis and Modeling
  Landi, Frontiers in plant science 2017
  • “...nitrate transporters (At1g12110, At1g69850, At1g32450, At1g27080, At1g69870, At4g21680), two major facilitator super family proteins (At1g52190, At3g16180), seven high affinity nitrate transporters (At1g08090, At1g08100, At5g60780, At5g60770, At1g12940, At3g45060, At5g14570), and six ammonium transporters (At4g13510, At1g64780, At1g64780, At4g28700, At3g24290, At2g38290) were selected at this purpose. The chloride channel...”
  • “...MAJOR FACILITATOR SUPER FAMILY A. THALIANA HIGH AFFINITY NITRATE TRANSPORTER Chloride Channel At1g52190 NT 1.11 At3g16180 NT 1.12 At1g08090 NT 2.1 . At1g08100 NT 2.2 . At5g60780 NT 2.3 At5g60770 NT 2.4 At1g12940 NT 2.5 At3g45060 NT 2.6 At5g14570 NT 2.7 At5g40890 CLCA Plasma membraneleaf phloem...”
• More

PTR11_ARATH / Q9SK99 Protein NRT1/ PTR FAMILY 5.15; AtNPF5.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G22570 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
24% identity, 89% coverage

• Genetic Architecture of Flowering Time Differs Between Populations With Contrasting Demographic and Selective Histories
  Neto, Molecular biology and evolution 2023
  • “...belonging to gene families associated with flowering time in Santo Anto: ATX1 (AT2G31650) and NPF5.15 (AT1G22570). ATX1 is a histone-lysine N -methyltransferase involved in the formation, placement, and identity of floral organs, and the epigenetic control of FLC ( Pien et al. 2008 ). ATX1 is...”
• Genome-wide identification of KANADI1 target genes
  Merelo, PloS one 2013
  • “...1 FDR replicate 2 Enrichment replicate 1 Enrichment replicate 2 Distance Location Distance REV/KAN1 binding AT1G22570 Major facilitator protein 1129 DOWN 1,19E-112 3,31E-68 13,5 6,2 920 UP 4085 AT1G25560 TEM1 2926 UP 2,15E-64 2,70E-31 11,7 4,9 3024 UP 61 AT1G51940 LysM-domain protein 1525 UP 1,22E-10 3,24E+02...”
• Assessing Global Transcriptome Changes in Response to South African Cassava Mosaic Virus [ZA-99] Infection in Susceptible Arabidopsis thaliana
  Pierce, PloS one 2013
  • “...3.90 1.75E-78 5.99 9.49E-55 AT4G25810 XTR6 (XYLOGLUCAN ENDOTRANSGLYCOSYLASE 6) 2.20 1.48E-06 2.03 1.29E-21 2.73 1.42E-17 AT1G22570 Proton-dependent oligopeptide transport (POT) family protein 2.26 9.53E-07 2.62 1.85E-39 2.22 2.38E-11 AT1G65390 ATPP2-A5 (ATPP2-A5) 2.36 6.08E-07 2.35 2.87E-31 2.29 3.87E-12 AT4G36000 Pathogenesis-related thaumatin family protein 2.41 7.73E-07 2.04 5.37E-22...”
• A proteomics dissection of Arabidopsis thaliana vacuoles isolated from cell culture
  Jaquinod, Molecular & cellular proteomics : MCP 2007
  • “...116,900 5.3 13 283 (6) 438 RND 2d Transp. 66 5 At1g22570 62,897 9.1 12 44 POT 2d Transp. NF NF At1g72140 61,347 8.2 12 34 POT 2d Transp. NF NF At2g02040...”

5a2oA / Q05085 Crystal structure of the nitrate transporter nrt1.1 from arabidopsis thaliana in complex with nitrate. (see paper)
24% identity, 90% coverage

• Ligand: nitrate ion (5a2oA)

LOC4338779 protein NRT1/ PTR FAMILY 3.1 from Oryza sativa Japonica Group
24% identity, 88% coverage

• Genome-Wide Identification and Characterization of Long Non-Coding RNAs in Roots of Rice Seedlings under Nitrogen Deficiency
  Qiu, Plants (Basel, Switzerland) 2023
  • “...Another lncRNA, MSTRG.4764.4, targets a member of the plant NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER (NRT1/PTR) family (LOC4338779), and existing research has proved that these plant proteins transport a wide variety of substrates: nitrate, peptides, amino acids, dicarboxylates, glucosinolates, IAA, and ABA [ 28 ]. The identification of...”

LOC100795929 protein NRT1/ PTR FAMILY 4.6 from Glycine max
24% identity, 94% coverage

• Transcriptome analysis and functional identification of GmMYB46 in soybean seedlings under salt stress
  Liu, PeerJ 2021
  • “...validate the transcriptome data. This selection included 5 up-regulated genes ( LOC100807235, LOC100816551, LOC100785783, LOC100787314, LOC100795929 ) and 5 down-regulated genes ( LOC100805378, LOC102663255, LOC100306125, LOC100787705, LOC100819491 ). qRT-PCR was conducted using Bio-Rad CFX96 PCR System (USA, Bio-Rad) with a 20 L reaction mixture. The mixture...”

PTR10_ARATH / Q9SK96 Protein NRT1/ PTR FAMILY 5.16; AtNPF5.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G22550 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
NP_173671 Major facilitator superfamily protein from Arabidopsis thaliana
24% identity, 97% coverage

• Mapping Genetic Variation in Arabidopsis in Response to Plant Growth-Promoting Bacterium Azoarcus olearius DQS-4T
  Plucani, Microorganisms 2023
  • “...1.75 10 18 Transmembrane protein 1 At1G14040 4812798 3.23 10 8 PHO1 homolog 3 1 At1G22550 7967378 4.68 10 7 NPF5.16 1 At1G52710 19638846 9.13 10 19 Rubredoxin-like superfamily protein 2 At2G18245 7939481 2.18 10 9 alpha/beta-Hydrolases superfamily protein 3 At3G14400 4812265 1.84 10 8 Ubiquitin-specific...”
• Comparative Transcriptome Analysis Reveals Common and Developmental Stage-Specific Genes That Respond to Low Nitrogen in Maize Leaves
  Guo, Plants (Basel, Switzerland) 2022
  • “...4.3 3.3 Zm00001d044529 ZmNPF6.2 AT2G26690 NPF6.2 NRT1/ PTR family 6.2 6.8 8.4 8.3 Zm00001d042684 ZmNPF5.16 AT1G22550 NPF5.16 NRT1/ PTR family 5.16 6.1 8.4 8.3 Zm00001d051525 ZmOPT4 AT5G64410 OPT4 oligopeptide transporter 4 1.8 2.3 2.7 Zm00001d045519 ZmOPT6 AT4G10770 OPT7 oligopeptide transporter 7 2.3 2.3 2.2 Zm00001d015702 ZmCLCG...”
• Tonoplast-localized nitrate uptake transporters involved in vacuolar nitrate efflux and reallocation in Arabidopsis
  He, Scientific reports 2017
  • “...Genome Initiative or GenBank/EMBL databases under the following accession numbers: NPF5.11 (At1g72130), NPF5.12 (At1g72140), NPF5.16 (At1g22550), NRT1.8 (At4g21680), CHL1 (At1g12110), SAND (At2g28390), Actin2 (At3g18780). Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations. Acknowledgements We thank Dr. Yi-Fang...”
• Shoot chloride exclusion and salt tolerance in grapevine is associated with differential ion transporter expression in roots
  Henderson, BMC plant biology 2014
  • “...NG11_35177_1429 VIT_18s0041g00670 GSVIVT01026058001 AT1G72140 0.89 7.91E-14 Proton-dependent oligopeptide transport (POT) family protein NG11_25530_14040 VIT_04s0008g03580 GSVIVT01035643001 AT1G22550 1.11 2.21E-24 Nitrate transporter 1.11 NG11_31776_20297 VIT_16s0050g01860 GSVIVT01028789001 AT5G24030 0.54 4.61E-05 SLAH3 (SLAC1 Homologue 3) CUST_21950_56777 VIT_07s0191g00070 GSVIVT01003419001 AT4G40010 1.01 1.28E-04 SNF1-related protein kinase 2.7 (SnRK2.7) CUST_41758_42394 VIT_00s0710g00020 GSVIVT01002389001 AT4G33950...”
• Overexpression of Fatty Acid Amide Hydrolase Induces Early Flowering in Arabidopsis thaliana
  Teaster, Frontiers in plant science 2012
  • “...protein 2.48 At1g10920 Encodes LOV1, a disease susceptibility gene 2.44 At1g71990 Lewis-type alpha 1,4-fucosyltransferase 2.42 At1g22550 Major facilitator superfamily protein 2.41 At1g17860 Kunitz family trypsin and protease inhibitor protein 2.40 At5g64440 AtFAAH (fatty acid amide hydrolase) modulates endogenous NAEs ( N -acylethanolamines) levels in plants 2.40...”
• The response and recovery of the Arabidopsis thaliana transcriptome to phosphate starvation
  Woo, BMC plant biology 2012
  • “...a persistent negative response of 2.8 fold. By contrast, two peptide transporter genes, At1g62200 and At1g22550 , identified as members of the PPR class, have been implicated in zinc hyper-accumulation. And, the gene for another carnitine transporter, OCT4 , displayed a PPR pattern with a 2.5...”
• Tonoplast-localized nitrate uptake transporters involved in vacuolar nitrate efflux and reallocation in Arabidopsis.
  He, Scientific reports 2017
  • GeneRIF: At1g22550 (NPF5.16) is involved in the nitrate from vacuoles into cytosol, thus serving as important player to modulate nitrate allocation between roots and shoots.

PTR34_ARATH / Q9LSF0 Protein NRT1/ PTR FAMILY 4.1; AtNPF4.1; Protein ABA-IMPORTING TRANSPORTER 3 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT3G25260 Major facilitator superfamily protein from Arabidopsis thaliana
23% identity, 91% coverage

• function: Involved in (+) and (-)-abscisic acid transport (ABA) and in gibberellin import.
• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...x x Nitrate (NPF family) NPF2.13/NRT1.7 At1g69870 x 2.48 x x Nitrate (NPF family) NPF4.1/AIT3 At3g25260 x x x 2.3 Nitrate (NPF family) NPF5.3/NRT1.8 At5g46040 x 4.1 x x Nitrate (NPF family) NPF5.6 At2g37900 x x 3.57 x Nitrate (NPF family) NPF5.12 At1g72140 2.03 x x...”
• Gibberellin and abscisic acid transporters facilitate endodermal suberin formation in Arabidopsis
  Binenbaum, Nature plants 2023
  • “...control oocytes ( Fig. 1b ). Co-expression of both NPF2.14 RNA and NPF4. 1 ( AT3G25260 ), which encodes a known GA importer, led to a reduced accumulation of non-membrane permeable GA 3 compared to oocytes expressing only NPF4.1 ( Fig. 1c ), further supporting that...”
• Abscisic Acid: Role in Fruit Development and Ripening
  Gupta, Frontiers in plant science 2022
  • “...ABA receptors ( Park et al., 2009 ). Furthermore, AIT2 ( At1g27040 ), AIT3 ( At3g25260 ) (does not discriminate between (+) and ()-ABA), and AIT4 ( At3g25280 ). ABA transporters of PTR family members localized at plasma membrane were also identified ( Kanno et al.,...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...]; ABA/GA 1/3/4/8/20 /MeJA [ 18 , 50 , 55 ] ABA; GA AtNPF4.1 AIT3 At3g25260 NPF4 ABA [ 39 ]; GA 1/3/4 /MeJA [ 18 , 54 ]; GA 3/4/8/20 [ 55 ] AtNPF4.2 AIT4 At3g25280 NPF4 GA 1/3 [ 18 ]; ABA [ 17...”
• Identification of an abscisic acid transporter by functional screening using the receptor complex as a sensor
  Kanno, Proceedings of the National Academy of Sciences of the United States of America 2012
  • “...Of the 11 cDNAs, four of them (At1g69850, At1g27040, At3g25260, and At3g25280) were able to induce an interaction between AD-ABI1 and BD-PYR1 in the presence of...”
  • “...the four candidate genes, At1g69850 (NRT1.2), At1g27040, At3g25260, and At3g25280, as ABA-IMPORTING TRANSPORTER (AIT) 1, 2, 3, and 4, respectively. Although...”
• High-resolution analysis of parent-of-origin allelic expression in the Arabidopsis Endosperm
  Wolff, PLoS genetics 2011
  • “.... We also identified the known imprinted genes FWA [31] , MYB3R2 [6] , and At3g25260 [6] in our MEG dataset as well as PHE1 [10] and At5g62110 [6] in the PEG dataset. Several known imprinted genes were not identified either due to low numbers of...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...genes. Some tissue-specific expression AtPTR genes could also be identified, for example, At1g27040, At4g21680 and At3g25260 in seed and siliques, At3g45710 and At3g45700 in root. Most of the AtPTR genes had relatively low expression level in mature pollen except At1g62200, At5g28470 and At5g01180. These genes were...”
• Extensive demethylation of repetitive elements during seed development underlies gene imprinting
  Gehring, Science (New York, N.Y.) 2009
  • “...Col-gl males. FWA is a control imprinted gene; AT3G25260 is biallelic. (B) RT-PCR sequencing chromatograms for the paternally expressed genes AT2G32370 and...”

B4FQ14 Peptide transporter PTR2 from Zea mays
23% identity, 88% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
  Santi, Frontiers in plant science 2017
  • “...2.21 GRMZM2G122712_T01 Q6AU97 Putative proton-dependent oligopeptide transporter (POT) 2.26 2.96 GRMZM2G009344_T01 B4FET6 ATPUP3 2.28 GRMZM2G026523_T01 B4FQ14 Peptide transporter PTR2 2.30 GRMZM2G167758_T01 Q9FMC7 Nuclear transport factor 2 (NTF2) family protein 2.32 AC185254.4_FGT002 Q6ZIV9 Putative ABC transporter 2.39 GRMZM2G311401_T01 A0A096T5V7 Uncharacterized protein 2.48 GRMZM2G027891_T01 Q0JB23 Os04g0561000 protein 2.54...”

D7TC02 Protein NRT1/ PTR family 6.2 from Vitis vinifera
25% identity, 93% coverage

• Dissecting the complex genetic basis of pre- and post-harvest traits in Vitis vinifera L. using genome-wide association studies
  García-Abadillo, Horticulture research 2024
  • “...\setlength{\oddsidemargin}{-69pt} \begin{document} $\rho$\end{document} = 0.936). This SNP, interestingly, resides within Vitvi11g00454, encoding a protein designated D7TC02. This protein, a member of the NRT1/PTR family, plays a role in the transmembrane transport of secondary metabolites in response to jasmonic acid. Furthermore, researchers recognize D7TC02 as the last...”

PTR19_ARATH / Q8H157 Protein NRT1/ PTR FAMILY 4.6; AtNPF4.6; Nitrate transporter 1.2; Nitrate transporter NTL1; Protein ABA-IMPORTING TRANSPORTER 1 from Arabidopsis thaliana (Mouse-ear cress) (see 6 papers)
TC 2.A.17.3.16 / Q8H157 Nitrate transporter 1.2 (Nitrate transporter NTL1) from Arabidopsis thaliana (see 7 papers)
AT1G69850 ATNRT1:2 (ARABIDOPSIS THALIANA NITRATE TRANSPORTER 1:2); calcium ion binding / transporter from Arabidopsis thaliana
NP_564978 nitrate transporter 1:2 from Arabidopsis thaliana
24% identity, 96% coverage

• function: Low-affinity proton-dependent nitrate transporter. Involved in constitutive nitrate uptake. Not involved in histidine or dipeptides transport. Involved in (+)-abscisic acid (ABA) transport, but not in gibberellin, indole-3-acetic acid or jasmonic acid import. Mediates cellular ABA uptake. Nitrate does not compete with abscisic acid as a substrate of NPF4.6 (PubMed:24084651).
  disruption phenotype: Reduced effect of ABA on seed germination and postgermination growth and increased number of open stomata.
• substrates: Abscisic acid, nitrate
  tcdb comment: Low-affinity proton-dependent nitrate transporter involved in constitutive nitrate uptake but not histidine or dipeptides transport. Involved in (+)-abscisic acid (ABA) transport, but not in gibberellin, indole-3-acetic acid or jasmonic acid import (Kanno et al. 2013)
• Plant nitrogen availability and crosstalk with phytohormones signallings and their biotechnology breeding application in crops
  Xing, Plant biotechnology journal 2023
  • “...O'Brien etal .( 2016 ); Kanno etal .( 2012 ) AtNPF4.2 At3g25280 AtNPF4.5 At1g27040 AtNPF4.6 At1g69850 AtNRT1.3 At3g21670 NO 3 transporters; N uptake and transport; regulated by CTK O'Brien etal .( 2016 ); Fan etal .( 2009 ); Wang etal .( 2012 ) AtNRT1.4 At2g26690 AtNRT1.7...”
• Expression of AtWRI1 and AtDGAT1 during soybean embryo development influences oil and carbohydrate metabolism
  Arias, Plant biotechnology journal 2022
  • “...Glyma.13G223800 2.4 2.4 2.8 2.5 2.4 1.9 2.2 1.3 2.5 4.1 2.9 4.5 687 0.89 AT1G69850 Nitrate transporter, ABA importer transporter 1 Glyma.09G074000 5.2 5.9 5.3 6.7 5.1 6.4 5.8 6.4 4.4 4.9 1936 0.89 AT1G53920 GDSLmotif lipase 5 Glyma.08G159500 1.0 1.9 1.5 2.0 2.0 2.2...”
• Regulation of Nitrate (NO₃) Transporters and Glutamate Synthase-Encoding Genes under Drought Stress in Arabidopsis: The Regulatory Role of AtbZIP62 Transcription Factor
  Rolly, Plants (Basel, Switzerland) 2021
  • “...in nitrate uptake. Belongs to the PTR2/POT transporter (TC 2.A.17) family [ 33 ] NRT1.2 AT1G69850 Protein NRT1/PTR family 4.6; Low-affinity proton-dependent nitrate transporter. Involved in constitutive nitrate uptake. Involved in (+)-abscisic acid (ABA) transport. Mediates cellular ABA uptake. Belongs to the PTR2/POT transporter (TC 2.A.17)...”
• Lasting consequences of psyllid (Bactericera cockerelli L.) infestation on tomato defense, gene expression, and growth
  Harrison, BMC plant biology 2021
  • “...late flowering and premature cell death in Arabidopsis." Physiologia plantarum 137.3 (2009): 249-263. Solyc05g006990.2 NPF4.6 AT1G69850 -0.29 protein NRT1/ PTR FAMILY 4.6 Low-affinity proton-dependent nitrate transporter; Involved in constitutive nitrate uptake; Involved in (+)-abscisic acid (ABA) transport; Mediates cellular ABA uptake Decreased abscisic acid transport; Decreased...”
  • “...for peroxisomal function and sustained matrix protein import." Plant physiology 151.3 (2009): 1354-1365. Solyc05g006990.2 NPF4.6 AT1G69850 -0.29 protein NRT1/ PTR FAMILY 4.6 Low-affinity proton-dependent nitrate transporter; Involved in constitutive nitrate uptake; Involved in (+)-abscisic acid (ABA) transport; Mediates cellular ABA uptake Decreased abscisic acid transport; Decreased...”
• Nectar biosynthesis is conserved among floral and extrafloral nectaries
  Chatt, Plant physiology 2021
  • “...xylem to the subnectariferous parenchyma by the cotton orthologs of the proton-coupled nitrate transporter NRT1.5 (AT1G69850; Tsay etal., 2007 ; Lin etal., 2008 ), which displays peak expression during the secretory stage in the floral and reproductive extrafloral nectaries. The transcriptome data also indicate that once...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...] AtNPF4.5 AIT2 At1g27040 NPF4 ABA [ 17 , 18 , 58 ] AtNPF4.6 NRT1.2/AIT1 At1g69850 NPF4 NO 3 [ 59 ]; ABA [ 17 , 18 , 58 ] AtNPF5.1 At2g40460 NPF51 ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF5.2 PTR3 At5g46050 NPF51 ABA/GA 1/3/4 [...”
• NRT1.1-Mediated Nitrate Suppression of Root Coiling Relies on PIN2- and AUX1-Mediated Auxin Transport
  Chai, Frontiers in plant science 2020
  • “...; BRI1 , AT4G39400 ; NIA1 , AT1G77760 ; NRT1.1 , AT1G12110 ; NRT1.2 , AT1G69850 ; NRT2.1 , AT1G08090 ; PIN2 , At5G57090 ; PIN3 , AT1G70940 ; PIN7 , AT1G23080 . Results Nitrate Deficiency Induces Root Coiling on Horizontal Plates To determine which nutrients...”
• The Consequences of a Disruption in Cyto-Nuclear Coadaptation on the Molecular Response to a Nitrate Starvation in Arabidopsis
  Chardon, Plants (Basel, Switzerland) 2020
  • “...The Cyt Nuc interaction reduced the mRNA accumulation of two nitrate transporters: NRT1.2 ( AtNPF4.6; AT1G69850 ) a both nitrate and ABA transporter [ 42 ] and NRT2.7 ( AT5G14570 ) a vacuolar high affinity nitrate transporter [ 43 ]. The induction of genes encoding enzymes...”
• More
• ABA-importing transporter (AIT1) synergies enhances exogenous ABA minimize heavy metals accumulations in Arabidopsis.
  Zhu, Journal of hazardous materials 2024 (PubMed)
  • GeneRIF: ABA-importing transporter (AIT1) synergies enhances exogenous ABA minimize heavy metals accumulations in Arabidopsis.
• Regulation of the stability and ABA import activity of NRT1.2/NPF4.6 by CEPR2-mediated phosphorylation in Arabidopsis.
  Zhang, Molecular plant 2021 (PubMed)
  • GeneRIF: Regulation of the stability and ABA import activity of NRT1.2/NPF4.6 by CEPR2-mediated phosphorylation in Arabidopsis.
• Arabidopsis NPF4.6 and NPF5.1 Control Leaf Stomatal Aperture by Regulating Abscisic Acid Transport.
  Shimizu, Genes 2021
  • GeneRIF: Arabidopsis NPF4.6 and NPF5.1 Control Leaf Stomatal Aperture by Regulating Abscisic Acid Transport.
• Abscisic acid (ABA)-importing transporter 1 (AIT1) contributes to the inhibition of Cd accumulation via exogenous ABA application in Arabidopsis.
  Pan, Journal of hazardous materials 2020 (PubMed)
  • GeneRIF: Abscisic acid (ABA)-importing transporter 1 (AIT1) contributes to the inhibition of Cd accumulation via exogenous ABA application in Arabidopsis.
• Arabidopsis NRT1.2 interacts with the PHOSPHOLIPASE Dα1 (PLDα1) to positively regulate seed germination and seedling development in response to ABA treatment.
  Li, Biochemical and biophysical research communications 2020 (PubMed)
  • GeneRIF: Arabidopsis NRT1.2 interacts with the PHOSPHOLIPASE Dalpha1 (PLDalpha1) to positively regulate seed germination and seedling development in response to ABA treatment.
• Nitrate does not compete with abscisic acid as a substrate of AtNPF4.6/NRT1.2/AIT1 in Arabidopsis.
  Kanno, Plant signaling & behavior 2013
  • GeneRIF: These results do not support the idea of a physiological linkage between nitrate and ABA signals through AtNPF4.6.

9bisA / Q63424 Cryo-em structure of the mammalian peptide transporter pept2 bound to amoxicillin (see paper)
24% identity, 82% coverage

• Ligand: 2-{1-[2-amino-2-(4-hydroxy-phenyl)-acetylamino]-2-oxo-ethyl}-5,5-dimethyl-thiazolidine-4-carboxylic acid (9bisA)

Q9FRU5 Nitrate transporter NRT1-2 from Glycine max
22% identity, 93% coverage

• cDNA-AFLP analysis of plant and pathogen genes expressed in grapevine infected with Plasmopara viticola
  Polesani, BMC genomics 2008
  • “...107 - 14-3-3 protein (Q93XW1) 1.13E-16 1534 CC GG TC57372 435 - Nitrate transporter NRT1-2 (Q9FRU5) 8.33E-94 1438 CG CC TC65826 270 - ABC transporter-like protein (Q9FT51) 7.38E-50 133 TC TT TC62785 219 - Calcium-transporting ATPase 8, plasma membr. 4.00E-23 662 CA GA TC69251 302 -...”

LOC110719467 protein NRT1/ PTR FAMILY 3.1-like from Chenopodium quinoa
21% identity, 93% coverage

• Single-cell transcriptomic analysis reveals the developmental trajectory and transcriptional regulatory networks of quinoa salt bladders
  Liu, Stress biology 2024
  • “...al. 2019 ). NITRATE TRANSPORTER 1 ( NRT1 / PTR FAMILY 3.1 - like / LOC110719467 ) is highly expressed in clusters 3 and 9 (Fig. 3 C), and studies have reported that NRT1 is involved in nitrate uptake, partitioning, and storage in higher plants (Ali...”

A0A1D6N629 Protein NRT1/ PTR FAMILY 5.10 from Zea mays
25% identity, 67% coverage

• Key factors identified by proteomic analysis in maize (Zea mays L.) seedlings' response to long-term exposure to different phosphate levels
  Sun, Proteome science 2018
  • “...chloroplastic 1.32 B6T7A1 Voltage-gated potassium channel beta subunit 0.8 A0A1D6KAA6 Protein NRT1/PTR family 8.3 1.35 A0A1D6N629 Protein NRT1/PTR family 5.10 0.68 ABC transporters A0A1D6NEQ4 ABC transporter B family member 9 2.34 A0A1D6G2R7 ABC transporter B family member 9 1.55 A0A1D6MRC7 ABC transporter B family member 21...”
  • “...induced. Moreover, two nitrate transporters, A0A1D6KAA6 (protein NRT1/PTR family 8.3, fold change=1.35 in roots) and A0A1D6N629 (protein NRT1/PTR family 5.10, fold change=0.68 in roots), were detected in roots under LP condition. Many ABC transporters were also significantly altered in roots. Among them, A0A1D6NEN5 (ABC transporter B...”

LOC8060993 protein NRT1/ PTR FAMILY 5.10 from Sorghum bicolor
24% identity, 94% coverage

• Heterogeneous root zone salinity mitigates salt injury to Sorghum bicolor (L.) Moench in a split-root system
  Zhang, PloS one 2019
  • “...0.02 1.39 -0.30 High-affinity nitrate transporter-activating protein 2.1 (Precursor) ( Oryza sativa subsp. japonica ) LOC8060993 -0.08 -0.04 -2.96 Protein NRT1/ PTR FAMILY 5.10 ( Arabidopsis thaliana ) LOC8085192 -1.62 1.57 -2.49 High-affinity nitrate transporter 2.2 ( Oryza sativa subsp. japonica ) LOC8071422 -0.73 1.87 -1.51...”

PTR12_ARATH / Q8VYE4 Protein NRT1/ PTR FAMILY 4.5; AtNPF4.5; Protein ABA-IMPORTING TRANSPORTER 2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT1G27040 nitrate transporter, putative from Arabidopsis thaliana
25% identity, 95% coverage

• function: Involved in abscisic acid transport.
• Plant nitrogen availability and crosstalk with phytohormones signallings and their biotechnology breeding application in crops
  Xing, Plant biotechnology journal 2023
  • “...N supply O'Brien etal .( 2016 ); Kanno etal .( 2012 ) AtNPF4.2 At3g25280 AtNPF4.5 At1g27040 AtNPF4.6 At1g69850 AtNRT1.3 At3g21670 NO 3 transporters; N uptake and transport; regulated by CTK O'Brien etal .( 2016 ); Fan etal .( 2009 ); Wang etal .( 2012 ) AtNRT1.4...”
• Abscisic Acid: Role in Fruit Development and Ripening
  Gupta, Frontiers in plant science 2022
  • “...proteins that act as ABA receptors ( Park et al., 2009 ). Furthermore, AIT2 ( At1g27040 ), AIT3 ( At3g25260 ) (does not discriminate between (+) and ()-ABA), and AIT4 ( At3g25280 ). ABA transporters of PTR family members localized at plasma membrane were also identified...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...At3g25280 NPF4 GA 1/3 [ 18 ]; ABA [ 17 , 58 ] AtNPF4.5 AIT2 At1g27040 NPF4 ABA [ 17 , 18 , 58 ] AtNPF4.6 NRT1.2/AIT1 At1g69850 NPF4 NO 3 [ 59 ]; ABA [ 17 , 18 , 58 ] AtNPF5.1 At2g40460 NPF51 ABA/GA...”
• Identification of tapetum-specific genes by comparing global gene expression of four different male sterile lines in Brassica oleracea
  Ma, Plant molecular biology 2015
  • “...59.137 0.499 0.687 1.923 A AT1G03390 HXXXD-type acyl-transferase family protein 3.376 0.819 0.309 0.931 A AT1G27040 Major facilitator superfamily protein 3.664 2.117 2.985 1.008 A AT1G36340 UBC31 Ubiquitin-conjugating enzyme 31 3.503 1.161 1.566 0.906 A AT1G52560 HSP20-like chaperones superfamily protein 49.751 1.362 1.769 0.772 A AT1G62940...”
• Spatial gradients in cell wall composition and transcriptional profiles along elongating maize internodes
  Zhang, BMC plant biology 2014
  • “...BAG (Q5N9K2) 0.93 0.92 0.94 At3g51780 E-40 AtBAG4 POT family protein (Q2R726) 0.84 0.93 0.90 At1g27040 E-83 - VP1/ABI3 (Q6Z3U3) 0.78 0.92 0.85 At4g32010 E-152 AtHSL1 MYB (Q0J3I9) 0.81 0.90 0.83 At5g67300 E-54 AtMYBR1 F-box (Q5VR67) 0.84 0.91 0.79 At2g26850 E-79 - Protein kinase (Q2RBK1) 0.96...”
• Identification of an abscisic acid transporter by functional screening using the receptor complex as a sensor
  Kanno, Proceedings of the National Academy of Sciences of the United States of America 2012
  • “...S1 A and B). Overrepresentation of At1g69850 and At1g27040 sequences in the screened population (SI Materials and Methods) suggested that they were good...”
  • “...1). Of the 11 cDNAs, four of them (At1g69850, At1g27040, At3g25260, and At3g25280) were able to induce an interaction between AD-ABI1 and BD-PYR1 in the...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...groups as OsPTR genes. Some tissue-specific expression AtPTR genes could also be identified, for example, At1g27040, At4g21680 and At3g25260 in seed and siliques, At3g45710 and At3g45700 in root. Most of the AtPTR genes had relatively low expression level in mature pollen except At1g62200, At5g28470 and At5g01180....”

PTR15_ARATH / Q56XQ6 Protein NRT1/ PTR FAMILY 4.4; AtNPF4.4; Nitrate transporter 1.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G33440 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
23% identity, 91% coverage

• Carbon and nitrogen signaling regulate FLOWERING LOCUS C and impact flowering time in Arabidopsis
  Gramma, Plant physiology 2024
  • “...AT1G69120 MAF1 Gramene: AT1G77080 MAF1 Araport: AT1G77080 NRT1.1 Gramene: AT1G12110 NRT1.1 Araport: AT1G12110 NRT1.13 Gramene: AT1G33440 NRT1.13 Araport: AT1G33440 FLC Gramene: AT5G10140 FLC Araport: AT5G10140 TPS1 Gramene: AT1G78580 TPS1 Araport: AT1G78580 References Abe M , Kobayashi Y , Yamamoto S , Daimon Y , Yamaguchi A...”
• BPB1 regulates rice (Oryza sative L.) panicle length and panicle branch development by promoting lignin and inhibiting cellulose accumulation
  Li, Molecular breeding : new strategies in plant improvement 2023
  • “...Arabidopsis homologous gene At1g59740 (NRT1/ PTR FAMILY 4.3), and At1g33440 (NRT1/ PTR FAMILY 4.4) clustered into the same clade (Fig. 5c; Fig. S5b). The amino...”
  • “...that BPB1 was highly homologous to Os04g0441800, At1g59740, and At1g33440, especially the PTR2 domain region (Fig. S5c). The mutations in BPB1 (403 aa) and BPB2...”
• Data-Mining of Barley to Identify Salt Stress Hub Genes, Gene Expression Analysis and Recombinant Plasmid Construction
  Sohrabi, Iranian journal of biotechnology 2023
  • “..., AT3G60340 and ARF19 . Module 11 ( Fig. 2D ) also contained SBPase , AT1G33440, CKA3 and 1-Apr genes. The results showed that SBPase gene is common between Cytoscape and R gene networks and is known as a key gene in both methods. Figure 2...”
• Potential transceptor AtNRT1.13 modulates shoot architecture and flowering time in a nitrate-dependent manner
  Chen, The Plant cell 2021
  • “...0.00 3.17 0.00 2.11 0.00 AT3G08690 UBC11 1.98 0.00 1.78 0.00 1.90 0.00 1.79 0.00 AT1G33440 NRT1.13 2.53 0.00 2.19 0.00 2.39 0.00 2.02 0.00 absolute FC 1.8 under nitrate-limited condition at 16 DAG AT2G30766 unknown protein 1.97 0.04 2.37 0.00 1.03 0.85 1.41 0.00 AT5G50665...”
  • “...article can be found in the Arabidopsis Genome Initiative databases under the following accession numbers: At1g33440 ( NRT1.13 ), At5g10140 ( FLC ), At5g15840 ( CO ), At1g65480 ( FT ), At2g45660 ( SOC1 ), At5g61850 ( LFY ), At1g13440 (GAPDH), At4g05320 (UBQ10), At4g40040 ( HIS3...”
• Functional variants of DOG1 control seed chilling responses and variation in seasonal life-history strategies in Arabidopsis thaliana
  Martínez-Berdeja, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...whole dataset, and the most significantly associated SNP on Chr. 1 was found closest to AT1G33440, a major facilitator superfamily protein ( Fig. 3 and SI Appendix , Fig. S9 B and Tables S2, S7, and S8 ). Taken together, our results suggest that correlations between...”
• Transcriptomic Analysis of Avocado Hass (Persea americana Mill) in the Interaction System Fruit-Chitosan-Colletotrichum
  Xoca-Orozco, Frontiers in plant science 2017
  • “...Response to bacterium 4.64 UN49784 AT3G62550 69 Response to molecule of fungal origin 5.12 UN02593 AT1G33440 79 Response to nematode 3.22 UN15753 AT3G16770 69 Response to other organism 3.27 UN39665 AT5G17760 68 Systemic acquired resistance 2.46 UN26087 AT2G38290 59 Systemic acquired resistance, salicylic acid mediated signaling...”
• Transcriptomic Analysis of Soil-Grown Arabidopsis thaliana Roots and Shoots in Response to a Drought Stress
  Rasheed, Frontiers in plant science 2016
  • “...of diverse gene families such as major facilitator super family (MFS) transporters [ AT1G08900, AT1G30560, AT1G33440, AT1G72140, AT1G80530, AT2G26690, AT2G34355, AT3G20460, AT3G45680, AT3G47960, AT4G19450, STP8 (AT5G26250), AT5G27350 , and AT5G62680 ], MATE efflux transporters ( AT1G71140, AT5G17700, AT5G19700 , and AT5G38030 ), microRNA genes [ MIR156b...”
  • “...MATE transporter ( AT5G17700 ), (L) MFS transporter ( AT1G30560 ), (M) MFS transporter ( AT1G33440 ), (N) OPT3 , (O) Raffinose synthase 5 , (P) SWEET 15 . Error bars represent standard deviation. Gene ontology (GO) and MapMan analysis GO enrichment analysis revealed that the...”
• The nitrate transporter (NRT) gene family in poplar
  Bai, PloS one 2013
  • “...and PtNRT1d. For instance, eight PtNRT genes are the orthologs of only two Arabidopsis AtNRT1s (At1G33440 and At1G97940) in subclade PtNRT1a. Six Populus PtNRT genes are orthologs of At1G22540 in subclade PtNRT1c. In subclade PtNRT1d, six Populus PtNRT1 genes are similar to At1G52190 and At3G16180. No...”

TC 2.A.17.2.1 / Q9P380 Peptide:H+ symporter (see 4 papers)
ptr2 / RF|NP_596417.1 probable peptide transporter ptr2 from Schizosaccharomyces pombe
SPBC13A2.04c PTR family peptide transporter from Schizosaccharomyces pombe
27% identity, 79% coverage

• substrates: H+, peptides
• An essential role for the Ino80 chromatin remodeling complex in regulation of gene expression during cellular quiescence
  Zahedi, Chromosome research : an international journal on the molecular, supramolecular and evolutionary aspects of chromosome biology 2023
  • “...0,00180399 SPNCRNA.1573 II 3020526 3022271 SPBC15D4.05-antisense-1 6,22415483 4,9082E-12 SPNCRNA.413 II 3150075 3150475 SPNCRNA.413 2,82207927 0,00847413 SPBC13A2.04c II 3405575 3408492 ptr2 2,25820836 0,00121891 SPBC2G2.17c II 3466270 3467797 SPBC2G2.17c 5,69625442 5,1176E-12 SPBC887.16 II 3574869 3575250 SPBC887.16 2,87571225 0,00131414 SPSNORNA.27 II 3654333 3654416 snoR47 2,08042095 0,0026702 SPNCRNA.1660 II 4049029...”
• Cellular economy in fission yeast cells continuously cultured with limited nitrogen resources
  Chikashige, Scientific reports 2015
  • “...(predicted) 2.19 2.33 3.32 2.58 cta3 P-type ATPase, calcium transporting Cta3 3.86 4.43 4.71 2.56 SPBC13A2.04c PTR family peptide transporter (predicted) 1.99 2.32 2.93 2.10 amt1 ammonium transporter Amt1 1.64 2.01 2.06 1.93 SPBC1683.02 adenine/adenosine deaminase family (predicted) 1.38 1.53 2.60 1.83 mug146 meiotically upregulated gene...”
• The Ubiquitin ligase Ubr11 is essential for oligopeptide utilization in the fission yeast Schizosaccharomyces pombe
  Kitamura, Eukaryotic cell 2012
  • “...utilization. S. pombe has a single PTR-type transporter gene, SPBC13A2.04c (referred to as ptr2 based on its homology to PTR2 in S. cerevisiae), that has not...”
• Response of Schizosaccharomyces pombe to zinc deficiency
  Dainty, Eukaryotic cell 2008
  • “...egd2 sks2 SPBPB2B2.05 rpb8 SPCP20C8.03 SPAP8A3.07c SPBC428.11 SPBC13A2.04c rpl34 SPBPB2B2.06c SPCC330.07c cdb4 meu19 hsp90 rps403 sod1 snz1 rpl1101 ssa1 rps801...”
• Global transcriptional responses of fission and budding yeast to changes in copper and iron levels: a comparative study
  Rustici, Genome biology 2007
  • “...subset of genes that are specifically downregulated in response to high copper ( ptr2 , SPBC13A2.04c, SPAP7G5.06, SPAC5H10.01, SPCC132.04c, SPCC1223.09, SPAC11D3.18c, SPAC11D3.15, and SPAC1039.08). Most of these genes are involved in amino acid metabolism. S. cerevisiae cannot compensate for the loss of Ace1p with a general...”

LOC9271385, XP_015621687 protein NRT1/ PTR FAMILY 4.3 from Oryza sativa Japonica Group
22% identity, 86% coverage

• The Roles of Phosphorus and Nitrogen Nutrient Transporters in the Arbuscular Mycorrhizal Symbiosis
  Rui, International journal of molecular sciences 2022
  • “...A0A072VHJ1 MtAMT2.5 AAL32128 MtNIP1 [ 142 ] Nitrate NP_001234127 SlNRT2.3 Solanum lycopersicum [ 105 ] XP_015621687 OsNPF4.5 Oryza sativa [ 11 ] XP_020406064.1 ZmNPF4.5 Zea mays XP_021311980.1 SbNPF4.5 Sorghum bicolor XP_015620477.1 OsNPF2.2 Oryza sativa [ 145 ] XP_015636060.1 OsNPF1.3 XP_015632236.1 OsNPF6.4 Organic nitrogen AAB69642 LjPTR Lotus...”
• Functional analysis of the OsNPF4.5 nitrate transporter reveals a conserved mycorrhizal pathway of nitrogen acquisition in plants
  Wang, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...data from this article can be found in NCBI with the following accession numbers: OsNPF4.5 (LOC9271385), OsNPF6.4 (LOC9271131), OsPT11 (LOC4324187), OsHA1 (LOC4331281), OsNAR2.1 (LOC4329861), OsNRT2.1 (LOC4328051), OsNRT2.2 (LOC4328052), OsNPF1.3 (LOC4327022), OsNPF5.4 (LOC4348864), OsNPF7.2 (LOC4330372), OsNPF8.3 (LOC4336852), OsAMT3.1 (LOC107276856), OsNR1 (LOC4330867), OsNR2 (LOC4345798), OsGS1.1 (LOC4330649), MtNPF4.5 (LOC11406786),...”

LOC4325015 protein NRT1/ PTR FAMILY 8.1 from Oryza sativa Japonica Group
24% identity, 95% coverage

• Ambient temperature regulates root circumnutation in rice through the ethylene pathway: transcriptome analysis reveals key genes involved
  Cai, Frontiers in plant science 2024
  • “...of OsERF81 and OsERF82 with OsYUCCA6 , as well as that of OsERF82 with OsNPF8.1 (LOC4325015). This underscores a substantial interplay between ethylene-responsive factor genes and both the auxin synthesis enzyme gene and auxin transport genes. With weight values surpassing 0.3, OsERF63 demonstrated co-expression with OsEGL1...”

Sb09g020280 No description from Sorghum bicolor
24% identity, 90% coverage

• Identification of novel drought-responsive microRNAs and trans-acting siRNAs from Sorghum bicolor (L.) Moench by high-throughput sequencing analysis
  Katiyar, Frontiers in plant science 2015
  • “...A (Sb02g004650); cytochrome P450, family 96, subfamily A, polypeptide 10 (Sb01g047610); Major facilitator superfamily protein (Sb09g020280); Xylanase inhibitor protein 1 precursor (CD223557, TC116590, TC130018) 15 novel-sbi-miR-229 RNA-binding (RRM/RBD/RNP motifs) family protein (Sb02g034650); auxin response factor 11 (Sb03g000530); Pentatricopeptide repeat (PPR) superfamily protein (Sb06g028710); formate dehydrogenase (Sb10g016920);...”

SS1G_10121 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
25% identity, 87% coverage

• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...- - - - 3.3 3.1 SS1G_09297 oligopeptide transporter - - - - - 2.8 SS1G_10121 MFS peptide transporter 5.9 7.4 5.7 3.0 - - SS1G_07522 MFS peptide transporter - - 2.1 - - 4.1 2.4 others SS1G_08628 MFS transporter 5.9 6.6 5.6 3.0 2.4 -...”

PTR16_ARATH / Q93VV5 Protein NRT1/ PTR FAMILY 4.3; AtNPF4.3; Nitrate transporter 1.14 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT1G59740 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
21% identity, 87% coverage

• Natural variation in root exudate composition in the genetically structured Arabidopsis thaliana in the Iberian Peninsula
  Subrahmaniam, The New phytologist 2025
  • “...GXM3 Metabolism Fatty acids 1 N.V1092 1 17345313 AT1G47317 Stress Alkaloids 2 N.V831 1 21976138 AT1G59740 NPF4.3 Nutrient Alkaloids 2 N.V831 1 21976138 AT1G59740 ARF1 Signaling Amino acids 1 N.V313* 1 22280140 AT1G60470 GOLS4 Stress Carbohydrates 1 N.V554 1 22319649 AT1G60600 ABC4 Nutrient Amino acid 2...”
• BPB1 regulates rice (Oryza sative L.) panicle length and panicle branch development by promoting lignin and inhibiting cellulose accumulation
  Li, Molecular breeding : new strategies in plant improvement 2023
  • “...13 41 Page 10 of 17 Arabidopsis homologous gene At1g59740 (NRT1/ PTR FAMILY 4.3), and At1g33440 (NRT1/ PTR FAMILY 4.4) clustered into the same clade (Fig. 5c;...”
  • “...showed that BPB1 was highly homologous to Os04g0441800, At1g59740, and At1g33440, especially the PTR2 domain region (Fig. S5c). The mutations in BPB1 (403 aa)...”
• Analysis of the impact of indole-3-acetic acid (IAA) on gene expression during leaf senescence in Arabidopsis thaliana
  Gören-Sağlam, Physiology and molecular biology of plants : an international journal of functional plant biology 2020
  • “...1 At3g52340 SUCROSE-PHOSPHATASE 2 (SPP2) 2 2 At4g18250 At1g59740 Receptor Serine/Threonine kinase-like protein NRT1/PTR FAMILY 4.3 2 2 2 2 At5g65920 ARM repeat...”
• Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction
  Amil-Ruiz, Frontiers in plant science 2016
  • “...AT2G38470 WRKY DNA-binding protein 33 Transcription factor, JA pathway 2.41 (3.58 1.52) 7.93E-03 M14B5 gene29081 AT1G59740 Peptide transporter PTR Protein secretion 2.39 7.93E-03 M5B8 gene24582 AT5G22950 Vacuolar protein sorting-associated protein 24 Protein secretion 2.22 7.93E-03 M12E12 * # gene21365 AT3G56400 WRKY DNA-binding protein 70 Transcription factor,...”
• Transcriptional programs regulated by both LEAFY and APETALA1 at the time of flower formation
  Winter, Physiologia plantarum 2015
  • “...AP1 direct high-confidence targets, three showed abnormal expression upon the shift to inductive photoperiod. OPT (At1g59740) is very strongly downregulated by photoperiod and is dependent on LFY and AP1 for this response. Three other transporters of this family were among the 196 LFY/AP1 targets: AT1g22540, AT1g52190...”
• Pre-symptomatic transcriptome changes during cold storage of chilling sensitive and resistant peach cultivars to elucidate chilling injury mechanisms
  Pons, BMC genomics 2015
  • “...NRT1-2 AT1G18880 NRT1.9 Oligopepetide transport PPN005F03 Oligopeptide transporter 7 AT4G10770 OPT7 PPN064F08 POT family, putative AT1G59740 NRT1/NPF4.3 Unknown transporter PPN066F09 Putative integral membrane protein AT5G19980 GONST4 Sugar partioning and homeostasis Is probably involved in the provision of GDP- sugars into the Golgi for CW polysaccharide synthesis...”
• Apomictic and sexual germline development differ with respect to cell cycle, transcriptional, hormonal and epigenetic regulation
  Schmidt, PLoS genetics 2014
  • “...; (HJ) AT1G76580, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein), an oligopeptide transporter (AT1G59740, Figure 3 K,L ), and a HIGH MOBILITY GROUP A protein (HMGA, AT1G14900, Figure 3 MO ). The probes were designed to have significant sequence homologies only to the respective...”
  • “...AT1G76580 a Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (HJ), an oligopeptide transporter, AT1G59740 (K,L), and AT1G14900, encoding the HIGH MOBILITY GROUP A protein. Gene expression and gene ontology enrichment analysis uncovers upregulation of spermidine metabolism in the apomictic initial cell Between sexual and...”
• In silico mining of microsatellites in coding sequences of the date palm (Arecaceae) genome, characterization, and transferability
  Aberlenc-Bertossi, Applications in plant sciences 2014
  • “...thaliana R: GTCCCAGCATGATTGCAGTA mPdIRD22 F: GGCTGTATGGGAAAGACCTG (GAA) 6 231271 PDK_20s1726541 2878 2895 Probable peptide/nitrate transporter At1g59740 4.00E-40 Arabidopsis thaliana R: CCTGCTGCATATTCTTCGTG mPdIRD24 F: GCTCCTGCAGAACCTGAAAC (AAG) 6 184 PDK_20s1762671 5194 5211 Probable nucleolar protein 5-1 2.00E-46 Arabidopsis thaliana R: GGACATCACCGTCCAATTCT mPdIRD25 F: CACTGGAAATTCAGGGCCTA (AGG) 6 193205 PDK_20s1831761...”
• More

PTR6_ARATH / Q9M817 Protein NRT1/ PTR FAMILY 1.2; AtNPF1.2; Nitrate transporter 1.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.17.3.13 / Q9M817 Probable peptide transporter At1g52190 from Arabidopsis thaliana (see 5 papers)
AT1G52190 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
NP_175630 Major facilitator superfamily protein from Arabidopsis thaliana
22% identity, 91% coverage

• function: Low-affinity nitrate transporter involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves. Not involved in dipeptides transport.
  disruption phenotype: Nrt1.11 and nrt1.12 double mutant is defective in high-nitrate-enhanced growth.
• substrates: peptides
• The AP2/ERF Transcription Factor ERF56 Negatively Regulating Nitrate-Dependent Plant Growth in <i>Arabidopsis</i>
  Yao, International journal of molecular sciences 2025
  • “...). In the nitrate import process ( Table S3 ), the transcription of NRT1.11 ( AT1G52190 ), NRT2.4 ( AT5G60770 ), and AT5G66816 was downregulated by the overexpression of ERF56 . NRT1.11 plays a role in the xylem-to-phloem transport of nitrate for redistributing xylem-borne nitrate under...”
• Oligo-Carrageenan Kappa Increases Expression of Genes Encoding Proteins Involved in Photosynthesis, C, N, and S Assimilation, and Growth in Arabidopsis thaliana
  Méndez, International journal of molecular sciences 2023
  • “...1.9 AT3G01550 PPT2 4.1 Nitrogen assimilation AT5G56860 GATA21 1.1 AT1G66200 GLN1-2 1.8 AT5G35630 GLN2 1.6 AT1G52190 NPF1.2 1.3 AT2G26690 NPF6.2 2.8 AT1G12110 NPF6.3 2.5 AT3G21670 NPF6.4 5.9 AT2G15620 NIR1 1.4 Sulfur uptake AT1G62180 APR2 2.9 AT4G21990 APR3 1.8 AT5G67520 APK4 3.4 AT2G43750 OASB 1.6 AT5G28030 DES1...”
• Membrane nanodomains and transport functions in plant
  Martinière, Plant physiology 2021
  • “...AT2G46800 (MTP1) Suspension cell cultures Yoshida et al., 2013 Nitrate Nitrate transporter (NRT) AT5G50200 (NTR3.1); AT1G52190 (NTR1.11) Suspension cell cultures/leaves Keinath et al., 2010 ; Demir et al., 2013 Nucleosides Equilibrative nucleoside transporter (ENT) AT4G05120 (ENT3) Suspension cell cultures Keinath et al., 2010 Peptides Peptide transporter...”
• Molecular Regulatory Networks for Improving Nitrogen Use Efficiency in Rice
  Hou, International journal of molecular sciences 2021
  • “...dependent K + translocation from root to shoot Transport [ 51 , 52 ] AtNRT1.11 AT1G52190 Arabidopsis Phloem-specific NO 3 transporter redistributing xylem-borne NO 3 to enhance plant growth Transport [ 53 ] AtNRT1.12 AT3G16180 Arabidopsis Phloem-specific NO 3 transporter redistributing xylem-borne NO 3 to enhance...”
• The Arabidopsis RLCK VI_A2 Kinase Controls Seedling and Plant Growth in Parallel with Gibberellin
  Valkai, International journal of molecular sciences 2020
  • “...GA2OX6 gibberellin 2-oxidase 6 0.58 0.044627 yes DEGs of NPF (NRT1/PTR FAMILY) Gibberellin Transporters ** AT1G52190 AT1G52190 Major facilitator superfamily protein, NPF1.2 a,b 1.60 0.001941 yes AT3G16180 AT3G16180 Major facilitator superfamily protein, NPF 1.1 a 1.79 0.001941 yes AT5G46050 PTR3 peptide transporter 3, NPF 5.2 a...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...At3g16180 NPF1 NO 3 [ 10 ]; ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF1.2 NRT1.11 At1g52190 NPF1 NO 3 [ 10 ]; GA 1/3/4 /MeJA [ 18 , 50 ] AtNPF2.3 NAXT2 At3g45700 NPF22 GA 1/3/4 [ 18 ]; NO 3 [ 51 ] AtNPF2.4 At3g45690...”
• The transcription factor WRKY22 is required during cryo-stress acclimation in Arabidopsis shoot tips
  Stock, Journal of experimental botany 2020
  • “...NUCLEASE IN BASAL DEFENSE RESPONSE 1 stress.abiotic.touch/wounding 38 AT1G67265 4.9 ROTUNDIFOLIA LIKE 21 development.unspecified 39 AT1G52190 4.9 NITRATE TRANSPORTER 1.11 transport.peptides and oligopeptides 40 AT5G49360 4.9 BETA-XYLOSIDASE 1 cell wall.degradation 41 AT1G01470 4.9 LATE EMBRYOGENESIS ABUNDANT 14 development 42 AT1G23730 4.9 BETA CARBONIC ANHYDRASE 3 TCA/org...”
• Deacclimation after cold acclimation-a crucial, but widely neglected part of plant winter survival
  Vyse, Journal of experimental botany 2019
  • “...2.1000 1.0704 Dihydroxyacetone kinase 3 AT1G51400 1.0300 5.6705 1.3250 Photosystem II 5 kD protein 4 AT1G52190 1.1590 4.2159 1.8424 Major facilitator superfamily protein, nitrate transporter 5 AT1G62660 2.6050 2.7248 1.1414 Glycosyl hydrolases family 32 protein 6 AT1G73330 2.3480 3.2504 2.0559 Drought-repressed 4 7 AT1G80920 1.4160 2.8915...”
• More
• Two phloem nitrate transporters, NRT1.11 and NRT1.12, are important for redistributing xylem-borne nitrate to enhance plant growth.
  Hsu, Plant physiology 2013
  • GeneRIF: NRT1.11 and NRT1.12 are involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves, and such nitrate redistribution is a critical step for optimal plant growth enhanced by increasing external nitrate.[NRT1.11]
• Exploring the Effects of Selenium and Brassinosteroids on Photosynthesis and Protein Expression Patterns in Tomato Plants under Low Temperatures
  Saeed, Plants (Basel, Switzerland) 2023
  • “...temperatures of 10/3 C. However, only 3 of the 13 proteins, namely, O04939, Q54YH4, and Q9M817, were significantly upregulated in plants exposed to low temperatures of 12/7 C ( Table S1 ). Functional analyses of the proteins revealed that they play diverse roles in cellular metabolism...”
  • “...The 35336 protein is involved in fruit ripening, and the findings revealed that Q9AXJ4, Q766C3, Q9M817, Q8GXG1, Q04057, O22769, Q94KK7, and Q766C2 were also differentially expressed in the tomato plants ( Table S2 ). The results of principal component analysis (PCA) revealed that only two proteins,...”
• Microgravity induces changes in microsome-associated proteins of Arabidopsis seedlings grown on board the international space station
  Mazars, PloS one 2014
  • “...transporter B family member 19 (ABC transporter ABCB.19) (AtABCB19) (Multidrug resistance protein 11) (P-glycoprotein 19) Q9M817 AT1G52190 0.39512 Probable peptide transporter At1g52190 Q9SMV6 AT5G17020 0.35214 Exportin 1A (Exportin1 (XPO1) protein) (Putative Exportin1 (XPO1) protein) (Putative exportin1 protein XPO1) Cytoskeleton B9DGT7 At1G50010 0.6263 Tubulin alpha-2 chain P29513...”

PTR18_ARATH / Q9SX20 Protein NRT1/ PTR FAMILY 3.1; AtNPF3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.17.3.6 / Q9SX20 Chloroplast nitrite uptake system, Nitr1-L from Arabidopsis thaliana (see paper)
AT1G68570 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
NP_177024 Major facilitator superfamily protein from Arabidopsis thaliana
23% identity, 91% coverage

• function: May act as an efflux-type nitrite transporter. Not regulated by the PII protein involved in the regulation of nitrite uptake into higher plant chloroplasts.
  disruption phenotype: Slower growth and delayed bolting. Nitrite accumulation in leaves.
• substrates: Nitrite
• Precocious cell differentiation occurs in proliferating cells in leaf primordia in Arabidopsis angustifolia3 mutant
  Ezaki, Frontiers in plant science 2024
  • “...proliferation. In contrast, upregulated genes in an3 did not show any apparent characteristics, except for AT1G68570, named NRT1/PTR FAMILY 3.1 ( NPF3 ) encoding a membrane-localized gibberellic acid (GA) transporter. A previous study has indicated that NPF3 plays a role in GA uptake in elongated endodermal...”
  • “...datasets, we identified a candidate gene associated with precocious cell differentiation in an3 cells. NPF3 (AT1G68570), which encodes a membrane-localized GA transporter, was upregulated in the an3 mutant ( Supplementary Figure5 , Table S2 ). The npf3 mutant is defective in GA accumulation in elongating endodermal...”
• Comparative transcriptome analysis reveals the phosphate starvation alleviation mechanism of phosphate accumulating Pseudomonas putida in Arabidopsis thaliana
  Srivastava, Scientific reports 2023
  • “...At1g22150 ), Sultr2;1 ( At5g10180 )] and nitrate [ NRT2:1 ( At1g08090 ), NPF3.1 ( At1g68570 ), transporters also showed overexpression in all the three treatments. Differential expression analysis of A. thaliana genes under phosphate starved condition A heat map of the top 20 upregulated and...”
• Nucleotide Imbalance, Provoked by Downregulation of Aspartate Transcarbamoylase Impairs Cold Acclimation in Arabidopsis
  Bellin, Molecules (Basel, Switzerland) 2023
  • “...FOLT1 0.76 1.05 0.65 PL folate AT5G16150 pGlcT 0.44 0.87 1.03 1.20 0.34 PL hexose AT1G68570 NPF3.1 2.69 2.35 0.66 0.72 PL nitrite AT4G32400 BT1-like 2.01 1.58 0.70 0.72 PL nucleotide AT1G61800 GPT2 5.90 7.61 0.39 1.65 PL Glc6P, TP AT1G58030 CAT2 1.40 1.32 0.62 TP...”
• Gibberellin and abscisic acid transporters facilitate endodermal suberin formation in Arabidopsis
  Binenbaum, Nature plants 2023
  • “...root elongation zone 28 . The process is dependent on the activity of NPF3.1 (NPF3, AT1G68570 ), a member of the NPF family, which has been shown to act as a dual-specificity GA and ABA importer 16 , 29 . The endodermis, the innermost cortical layer...”
• Nano-Strainer: A workflow for the identification of single-copy nuclear loci for plant systematic studies, using target capture kits and Oxford Nanopore long reads
  Scheunert, Ecology and evolution 2023
  • “...Low 4 Accepted At5g65380 (#43) GGTCCTGCCATCTTCAGTCG AGACAAGGCCTATCACCGAAG MATE efflux family protein 2492 Med 2 Accepted At1g68570 (#44) GAGCTTGACACCTTTGCTTGG AGCTCAACCTCATGATCTTTGTG Protondependent oligopeptide t. f. 1719 Med 1 (2) 4 Amplified 2? 41 41 41 At3g46630 No primer design possible n.a. n.a. n.a. n.a. n.a. n.a. n.a. At5g17560...”
• Sucrose rather than GA transported by AtSWEET13 and AtSWEET14 supports pollen fitness at late anther development stages
  Wang, The New phytologist 2022
  • “...or GenBank/EMBL databases under the following accession numbers: AtSWEET9 (AT2G39060), AtSWEET13 (AT5G50800), AtSWEET14 (AT4G25010), AtNPF3.1 (AT1G68570). Results AtSWEET13 and AtSWEET14 expressed at late anther development stages AtSWEET13 and AtSWEET14 transcripts were detected in stamens at latestage flower development stages using GUS reporter under the control of...”
• Transcriptome and Small RNA Sequencing Reveal the Mechanisms Regulating Harvest Index in Brassica napus
  Zhang, Frontiers in plant science 2022
  • “...balance and transport include members of the NITRATE TRANSPORTER1/PEPTIDE TRANSPORTER (NPF) family, such as AtNPF3.1 (At1g68570) ( Yang et al., 2017 ) and AtNPF6.2 (At2g26690) ( Tong et al., 2016 ); AtNRT1.7/NPF2.13 (At1g69870) also plays important roles in source-to-sink remobilization of nitrate in Arabidopsis ( Fan...”
• Molecular Regulatory Networks for Improving Nitrogen Use Efficiency in Rice
  Hou, International journal of molecular sciences 2021
  • “...transporter and contribution to NO 3 translocation to the shoot Transport [ 54 ] AtNPF3.1 AT1G68570 Arabidopsis Encoding pathogen-inducible NO 3 /NO 2 transporters Uptake [ 55 ] AtNPF5.5 AT2G38100 Arabidopsis Affecting N accumulation in Arabidopsis embryo Uptake [ 56 ] AtNRT2.5 AT1G12940 Arabidopsis Loading NO...”
• More
• N availability modulates the role of NPF3.1, a gibberellin transporter, in GA-mediated phenotypes in Arabidopsis.
  David, Planta 2016 (PubMed)
  • GeneRIF: gene expression is promoted by limiting nitrogen nutrition
• Members of the NPF3 transporter subfamily encode pathogen-inducible nitrate/nitrite transporters in grapevine and Arabidopsis.
  Pike, Plant & cell physiology 2014 (PubMed)
  • GeneRIF: AtNPF3.1 is a low-affinity transporter for both nitrate and nitrite. AtNPF3.1 is up-regulated in the leaves of plants infected by Erysiphe necator. [AtNPF3.1]

TC 2.A.17.2.3 / U9UKY5 Dipeptide uptake porter, Ptr2 from Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194)
23% identity, 97% coverage

• substrates: dipeptides
  tcdb comment: Transports dipeptides such as Ala-Leu, Ala-Tyr and Tyr-Ala (Belmondo et al. 2014)

PTR13_ARATH / Q9LFX9 Protein NRT1/ PTR FAMILY 2.12; AtNPF2.12; Nitrate transporter 1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.17.3.14 / Q9LFX9 Nitrate transporter 1.6 from Arabidopsis thaliana (see 4 papers)
AT1G27080 NRT1.6 (NITRATE TRANSPORTER 1.6); low affinity nitrate transmembrane transporter/ transporter from Arabidopsis thaliana
23% identity, 95% coverage

• function: Low-affinity proton-dependent nitrate transporter. Not involved in dipeptides transport. Involved in delivering nitrate for seed development.
  disruption phenotype: Aberrant embryo development and increased seed abortion. Reduced seed nitrate content.
• substrates: nitrate
• Gibberellin and abscisic acid transporters facilitate endodermal suberin formation in Arabidopsis
  Binenbaum, Nature plants 2023
  • “...to promote suberization. NPF2.12 and NPF2.13 are plasma membrane-localized GA and ABA importers NPF2.12 ( AT1G27080 ) and its close paralog NPF2.13 ( AT1G69870 ) form a phylogenetic sub-clade with NPF2.14 ( Fig. 3a , Sup. Fig. 8 ). We hypothesized that due to this proximity...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “.../4MTB [ 20 ]; 8MTO [ 47 ]; GA 3 [ 55 ] AtNPF2.12 NRT1.6 At1g27080 NPF21 NO 3 [ 56 ]; GA 1/3 [ 18 ] AtNPF2.13 NRT1.7 At1g69870 NPF21 NO 3 [ 57 ]; 4MTB [ 20 ]; GA 1/3/4 /MeJA [ 18 ]...”
• The Expected and Unexpected Roles of Nitrate Transporters in Plant Abiotic Stress Resistance and Their Regulation
  Zhang, International journal of molecular sciences 2018
  • “...limited [ 26 , 27 , 28 , 29 , 30 ] AtNPF2.12 / AtNRT1.6 At1g27080 Arabidopsis thaliana Positively regulates seed abortion rate under nitrogen starvation [ 31 ] AtNPF2.13 / AtNRT1.7 At1g69870 Arabidopsis thaliana Inhibits plant growth retardation upon nitrogen starvation [ 32 ] AtNPF7.2...”
• Nitrate Uptake Affects Cell Wall Synthesis and Modeling
  Landi, Frontiers in plant science 2017
  • “...(Aoki et al., 2016 ). In detail, six low affinity nitrate transporters (At1g12110, At1g69850, At1g32450, At1g27080, At1g69870, At4g21680), two major facilitator super family proteins (At1g52190, At3g16180), seven high affinity nitrate transporters (At1g08090, At1g08100, At5g60780, At5g60770, At1g12940, At3g45060, At5g14570), and six ammonium transporters (At4g13510, At1g64780, At1g64780, At4g28700,...”
  • “...TRANSPORTER A. THALIANA AMMONIUM TRANSPORTER At1g12110 NT 1.1. At1g69850 NT 1.2 . At1G32450 NT 1.5 At1G27080 NT 1.6 At1g69870 NT 1.7 . At4g21680 NT 1.8 . At4g13510 AMT 1.1 At1g64780 AMT 1.2 At4g28700 AMT 1.4 At2g38290 AMT 2 Guard cellslateral roots Roots hairs and epidermids Roots...”
• Endogenous rhythmic growth in oak trees is regulated by internal clocks rather than resource availability
  Herrmann, Journal of experimental botany 2015
  • “...x 1.77 1.29 AT2G38290 0.0 ATAMT2. AMT2;1. Probable peptide nitrate transporter comp43246_c1_seq1 x 1.84 2.27 AT1G27080 7e-81 NRT1.6 Gibberellins Gibberellin-regulated protein comp29599_c0_seq1 x 6.58 3.49 7.59 AT5G15230 9e-32 GASA4 | GAST1 Gibberellin 20-oxidase comp7575_c0_seq1 x 6.86 6.43 AT5G51810 1e-44 GA20OX2. Auxins Auxin influx carrier component comp38228_c2_seq1...”
• Complex phylogeny and gene expression patterns of members of the NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER family (NPF) in wheat
  Buchner, Journal of experimental botany 2014
  • “...OsNPF6.2 Loc_Os01g37590 AtNPF7.3 At1g32450 BdNPF7.10 BdNPF7.11 Bradi3g52096 Bradi3g53380 OsNPF7.9 OsNPF7.10 OsNPF7.11 Loc_Os02g46460 Loc_Os06g21900 Loc_Os02g48570 AtNPF2.12 At1g27080 N/A N/A N/A N/A AtNPF2.13 At1g69870 BdNPF2.6 Bradi2g58470 OsNPF2.5 Loc_Os01g68510 AtNPF7.2 At4g21680 N/A N/A N/A N/A AtNPF2.9A At1g18880 BdNPF2.4 Bradi4g00530 OsNPF2.2 OsNPF2.3 Loc_Os12g44100 Loc_Os12g44110 AtNPF2.10 At3g47960 N/A N/A N/A N/A...”
• Dichotomy in the NRT gene families of dicots and grass species
  Plett, PloS one 2010
  • “...LOC_Os02g46460.1 LOC_Os02g48570.1 ZmNRT1.5A ZmNRT1.5B GRMZM2G044851_P01 GRMZM2G061303_P01 SbNRT1.5A SbNRT1.5B Sb04g031320.1 Sb04g029890.1 BdNRT1.5A BdNRT1.5B Bradi3g52100.1 Bradi3g53380.1 AtNRT1.6 AT1G27080 N/A N/A N/A N/A N/A N/A N/A N/A N/A N/A AtNRT1.7 AT1G69870 PtNRT1.7 POPTR_0010s04370.1 OsNRT1.7 LOC_Os01g68510.1 N/A N/A N/A N/A BdNRT1.7 Bradi2g58470.1 AtNRT1.8 AT4G21680 PtNRT1.8 POPTR_0014s17750.1 N/A N/A N/A N/A...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...the special role of petiole in nitrate homeostasis [ 28 ]. AtNRT1.5 (At1g32450) and AtNRT1.6 (At1g27080) were both plasma membrane proteins. AtNRT1.5 was expressed in root pericycle cells close to the xylem and participated in root xylem loading of nitrate [ 29 ] while AtNRT1.6 was...”

XP_003588616 protein NRT1/ PTR FAMILY 1.2 from Medicago truncatula
23% identity, 97% coverage

• Functional assessment of the Medicago truncatula NIP/LATD protein demonstrates that it is a high-affinity nitrate transporter.
  Bagchi, Plant physiology 2012
  • GeneRIF: NIP-3 plays a role in root architecture, nodulation, and nitrogen fixation.

TC 2.A.17.3.10 / A6NIM6 solute carrier family 15, member 5 from Homo sapiens (see paper)
25% identity, 91% coverage

• substrates: dipeptides, tripeptides
  tcdb comment: Function unknown as of 1/17, but probably a di- and tri-peptide uptake porter (Verri et al. 2016). The tissue expression profile has been reported (Sreedharan et al. 2011)
• THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
  Alexander, British journal of pharmacology 2017
  • “...evidence to suggest the existence of a fifth member of this transporter family, SLC15A5 ( A6NIM6 ; ENSG00000188991 ), but to date there is no established biological function or reported pharmacology for this protein [ 498 ]. Further reading on SLC15 family of peptide transporters Smith...”

AFUA_7G01490, Afu7g01490 MFS peptide transporter Ptr2, putative from Aspergillus fumigatus Af293
23% identity, 82% coverage

• A Novel Zn2-Cys6 Transcription Factor AtrR Plays a Key Role in an Azole Resistance Mechanism of Aspergillus fumigatus by Co-regulating cyp51A and cdr1B Expressions
  Hagiwara, PLoS pathogens 2017
  • “...0.03 0.03 conserved hypothetical protein Afu5g14740 fleA 91.6 9.3 6.7 0.10 0.07 fucose-specific lectin FleA Afu7g01490 ptr2 149.7 23.4 27.8 0.16 0.19 MFS peptide transporter Ptr2, putative Afu704920 138.3 20.1 16.6 0.15 0.12 hypothetical protein Afu7g04930 pr1 26.7 0.7 2.2 0.03 0.08 alkaline serine protease (PR1)/allergen...”
• The temporal dynamics of differential gene expression in Aspergillus fumigatus interacting with human immature dendritic cells in vitro
  Morton, PloS one 2011
  • “...decay protein 3 AFUA_2G12450 hydroxymethylglutaryl-CoA lyase AFUA_8G05710 MFS sugar transporter Stl1 AFUA_2G04230 fumarylacetoacetate hydrolase FahA AFUA_7G01490 MFS peptide transporter Ptr2 AFUA_5G06680 4-aminobutyrate transaminase GatA AFUA_4G09110 cytochrome c peroxidase Ccp1 AFUA_1G13110 4-coumarate-CoA ligase AFUA_5G14660 GABA permease AFUA_5G01740 deoxyhypusine synthase AFUA_6G00630 MFS transporter AFUA_3G01580 GMC oxidoreductase AFUA_3G01580 GMC...”
  • “...synthase PabaA AFUA_5G15010 arsenite efflux transporter (ArsB) Transport Routes (p: 0.046) Peptide transport (p: 0.12) AFUA_7G01490 MFS peptide transporter Ptr2 AFUA_7G01490 MFS peptide transporter Ptr2 rRNA processing (p: 0.06) AFUA_6G08910 tRNA methyltransferase AFUA_8G05430 ribosome biogenesis protein Noc4 AFUA_8G04820 ribonuclease P complex subunit Pop2 *Number of entries...”

B6TSV4 Peptide transporter PTR2 from Zea mays
24% identity, 91% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
  Santi, Frontiers in plant science 2017
  • “...transporter 2.02 GRMZM2G072955_T01 M8CTF4 Chloride channel protein 2.06 2.02 GRMZM2G153920_T01 B4FQN6 Sorbitol transporter 2.07 GRMZM2G137421_T01 B6TSV4 Peptide transporter PTR2 2.09 2.12 GRMZM2G457523_T01 Q2QLJ1 Sodium/hydrogen exchanger family protein, expressed 2.10 GRMZM5G872392_T01 B6T9U6 Bidirectional sugar transporter SWEET 2.15 AC186166.3_FGT008 A0A096PGB1 Uncharacterized protein 2.16 GRMZM2G112456_T01 C0HIN0 Oligopeptide transporter 4...”
  • “...component Sec15 2.71 GRMZM2G335218_T01 K7V706 Ammonium transporter 2.80 4.26 GRMZM2G055545_T01 A0A096QQK0 Uncharacterized protein 2.88 GRMZM2G347457_T01 B6TSV4 Peptide transporter PTR2 3.47 GRMZM2G070500_T01 B6TIX8 Nodulin-like protein 3.62 GRMZM2G061495_T01 Q7XMZ2 OSJNBa0027G07.3 protein 3.20 GRMZM5G865543_T01 B6SUB5 Electron carrier/electron transporter/iron ion binding protein 3.16 GRMZM2G476069_T01 M8C905 Nitrate/chlorate transporter 2.89 GRMZM2G057611_T01 Q67VA9...”

PTR38_ARATH / Q9M1E1 Protein NRT1/ PTR FAMILY 2.6; AtNPF2.6; Probable nitrate excretion transporter 2; Protein NAXT1-like 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G45660 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
23% identity, 86% coverage

• function: Transporter involved in a passive nitrate efflux.
• The Root-Colonizing Endophyte Piriformospora indica Supports Nitrogen-Starved Arabidopsis thaliana Seedlings with Nitrogen Metabolites
  Scholz, International journal of molecular sciences 2023
  • “...5.63 3.61 Nitrate (NRT2 family) AtNRT2.6 At3g45060 x x 3.85 5.14 Nitrate (NPF family) NPF2.6 At3g45660 x 3.34 x x Nitrate (NPF family) NPF2.8/NRT1.9 At5g28470 x 4.49 x x Nitrate (NPF family) NPF2.13/NRT1.7 At1g69870 x 2.48 x x Nitrate (NPF family) NPF4.1/AIT3 At3g25260 x x x...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...] ABA AtNPF2.5 At3g45680 NPF22 ABA/GA 1/3/4 [ 18 ]; chloride [ 22 ] AtNPF2.6 At3g45660 NPF22 GA 1/4 /MeJA [ 18 ] AtNPF2.7 NAXT1 At3g45650 NPF22 NO 3 [ 52 ]; GA 1/3/4 /MeJA [ 18 ] AtNPF2.9 NRT1.9/GTR3 At1g18880 NPF21 NO 3 [ 53...”
• Dehydration stress extends mRNA 3' untranslated regions with noncoding RNA functions in Arabidopsis
  Sun, Genome research 2017
  • “...used for this plot. ( C ) The IGV Genome Browser view showing NAXT1 and AT3G45660 . Blue color represents read abundance of forward strand. Extended 3 UTRs is depicted by a red rectangle. T-DNA insertion site is indicated by a black inverted triangle. ( D...”
  • “...expression levels of NAXT1 ( top ), NAXT1 extended 3 UTR ( middle ), and AT3G45660 ( bottom ) in WT and naxt1-1 mutant. Transcript levels were normalized to ACT2 expression. The expression level of each gene in WT plants grown in normal condition (NC) was...”
• ePlant and the 3D data display initiative: integrative systems biology on the world wide web
  Fucile, PloS one 2011
  • “...ePlant Sequence Explorer. A) Screenshot depicting a cluster of polymorphic sites mapped to the locus At3g45660. B) Screenshot depicting a 3D alignment of putative orthologs and paralogs of TIR1 auxin receptor encoded by At3g62980. ePlant Molecular Interactions Explorer The abstraction of biological systems as networks is...”
• Genomic survey, characterization and expression profile analysis of the peptide transporter family in rice (Oryza sativa L.)
  Zhao, BMC plant biology 2010
  • “...AtPTR genes in 24 development stages released the expression profile of 51 genes except At1g72125, At3g45660 and At3g54450 (Additional file 7 ). Obviously, the expression patterns of AtPTR genes fell into the similar groups as OsPTR genes. Some tissue-specific expression AtPTR genes could also be identified,...”

LOC8062188 protein NRT1/ PTR FAMILY 4.3 from Sorghum bicolor
22% identity, 87% coverage

• Functional analysis of the OsNPF4.5 nitrate transporter reveals a conserved mycorrhizal pathway of nitrogen acquisition in plants
  Wang, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...(LOC4336852), OsAMT3.1 (LOC107276856), OsNR1 (LOC4330867), OsNR2 (LOC4345798), OsGS1.1 (LOC4330649), MtNPF4.5 (LOC11406786), ZmNPF4.5 (LOC103652484), and SbNPF4.5 (LOC8062188). Supplementary Material Supplementary File Supplementary File This work was supported by National Key Research and Development Program of China (2016YFD0100700), National Natural Science Foundation of China (31572188, 31372121), the Basic...”

PTR35_ARATH / Q9LSE8 Protein NRT1/ PTR FAMILY 4.2; AtNPF4.2; Protein ABA-IMPORTING TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT3G25280 Major facilitator superfamily protein from Arabidopsis thaliana
23% identity, 93% coverage

• function: Involved in abscisic acid transport.
• Plant nitrogen availability and crosstalk with phytohormones signallings and their biotechnology breeding application in crops
  Xing, Plant biotechnology journal 2023
  • “...under different N supply O'Brien etal .( 2016 ); Kanno etal .( 2012 ) AtNPF4.2 At3g25280 AtNPF4.5 At1g27040 AtNPF4.6 At1g69850 AtNRT1.3 At3g21670 NO 3 transporters; N uptake and transport; regulated by CTK O'Brien etal .( 2016 ); Fan etal .( 2009 ); Wang etal .( 2012...”
• Abscisic Acid: Role in Fruit Development and Ripening
  Gupta, Frontiers in plant science 2022
  • “...), AIT3 ( At3g25260 ) (does not discriminate between (+) and ()-ABA), and AIT4 ( At3g25280 ). ABA transporters of PTR family members localized at plasma membrane were also identified ( Kanno et al., 2012 ). AtABCG25 and AtABCG31 of ABCG subfamily are localized in the...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...GA 1/3/4 /MeJA [ 18 , 54 ]; GA 3/4/8/20 [ 55 ] AtNPF4.2 AIT4 At3g25280 NPF4 GA 1/3 [ 18 ]; ABA [ 17 , 58 ] AtNPF4.5 AIT2 At1g27040 NPF4 ABA [ 17 , 18 , 58 ] AtNPF4.6 NRT1.2/AIT1 At1g69850 NPF4 NO 3...”
• Deficiencies in the formation and regulation of anther cuticle and tryphine contribute to male sterility in cotton PGMS line
  Zhang, BMC genomics 2020
  • “...regulated by ABA, such as Ghir_A01G008890 ( AT1G16310 ), Ghir_D01G009320 ( AT1G16310 ), Ghir_D07G021480 ( AT3G25280) , Ghir_D08G014410 ( MAKR6 ), Ghir_D11G032630 ( AT3G05500 ), together with Ghir_A07G002060 ( MYB7 ), Ghir_D10G003560 ( CHLI1 ) and Ghir_A12G017450 ( MYB16 ) (Fig. 6 a). Further, we analyzed...”
• Identification of an abscisic acid transporter by functional screening using the receptor complex as a sensor
  Kanno, Proceedings of the National Academy of Sciences of the United States of America 2012
  • “...11 cDNAs, four of them (At1g69850, At1g27040, At3g25260, and At3g25280) were able to induce an interaction between AD-ABI1 and BD-PYR1 in the presence of 0.1 M...”
  • “...four candidate genes, At1g69850 (NRT1.2), At1g27040, At3g25260, and At3g25280, as ABA-IMPORTING TRANSPORTER (AIT) 1, 2, 3, and 4, respectively. Although it was...”
• Meta-analysis of the expression profiles of the Arabidopsis ESCRT machinery
  Richardson, Plant signaling & behavior 2011
  • “...family protein; transmembrane receptor activity AT3G25280 Major facilitator superfamily protein; oligopeptide transporter activity AT4G04690 Protein...”

AO090010000229 No description from Aspergillus oryzae RIB40
23% identity, 84% coverage

• Sequence- and Structure-Based Functional Annotation and Assessment of Metabolic Transporters in Aspergillus oryzae: A Representative Case Study
  Raethong, BioMed research international 2016
  • “...electrochemical potential-driven transporters AO090003000050 2.A.1.7.1 L-fucose permease AO090012000623 2.A.1.8.5 Nitrate transporter AO090010000135 2.A.100.1.3 Iron-regulated transporter AO090010000229 2.A.17.2.2 Proton-dependent oligopeptide transporter AO090026000828 2.A.19.4.4 Sodium/potassium/calcium exchanger AO090009000637 2.A.2.6.1 Alpha-glucoside permease AO090003001404 2.A.20 Phosphate transporter AO090012000901 2.A.20.2.2 Phosphate transporter AO090103000274 2.A.22.3.2 Sodium and chloride dependent GABA transporter AO090009000405 2.A.29.1.3...”

Q5Z6P7 Os06g0264500 protein from Oryza sativa subsp. japonica
24% identity, 85% coverage

• An integrated "omics" approach to the characterization of maize (Zea mays L.) mutants deficient in the expression of two genes encoding cytosolic glutamine synthetase.
  Amiour, BMC genomics 2014
  • “...28.12 TC270988 Signalling Protein phosphatase type-2C {Zm} Q9FQY2 23.61 TC253650 Transport Putative nitrite transporter {Os} Q5Z6P7 22.38 TC276810 Signalling Putative calcium binding protein {Os} Q652U8 22.14 TC271736 Translation Ribosomal protein S21-like protein {Os} Q6YUV4 18.77 AZM4_72986 Nuclesome assembly Histone H2B.2 {Zm} P30756 17.14 TC264476 Transcription MA3...”

PTR20_ARATH / Q9CAR9 Putative protein NRT1/ PTR FAMILY 2.14; AtNPF2.14 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G69860 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
22% identity, 94% coverage

• Gibberellin and abscisic acid transporters facilitate endodermal suberin formation in Arabidopsis
  Binenbaum, Nature plants 2023
  • “..., GA7, GA9 and GA 12 ) 34 . The screen has identified NPF2.14 ( AT1G69860 ) as a potential GA exporter. At the end of assay, NPF2.14-expressing oocytes contained significantly reduced GA levels compared to control oocytes ( Fig. 1a ). This suggests that NPF2.14...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...3 [ 57 ]; 4MTB [ 20 ]; GA 1/3/4 /MeJA [ 18 ] AtNPF2.14 At1g69860 NPF21 4MTB [ 20 ] AtNPF3.1 Nitr At1g68570 NPF3 NO 3 /NO 2 [ 12 ]; ABA/GA 1/3/4/8/20 /MeJA [ 18 , 50 , 55 ] ABA; GA AtNPF4.1 AIT3...”
• Genome-wide identification, classification and transcriptional analysis of nitrate and ammonium transporters in Coffea
  Santos, Genetics and molecular biology 2017
  • “...This gene is in the super-group D, group IV E with the ortholog AtNRT1;7 ( At1g69860 ) ( Figure S2 ), that is expressed in phloem of older leaves, more specifically restricted to the sieve element and companion cell complex ( Fan et al ., 2009...”

DDB_G0272550 hypothetical protein from Dictyostelium discoideum AX4
23% identity, 82% coverage

• A set of genes conserved in sequence and expression traces back the establishment of multicellularity in social amoebae
  Schilde, BMC genomics 2016
  • “...homologous recombination (Additional file 3 : Figure S4). These genes, DDB_G0275521, DDB_G0287037 DDB_G0288963, DDB_G0269826 and DDB_G0272550 were both spore-enriched in PP and upregulated during encystation. DDB_G0272550 could not be knocked out despite three attempts. For none of the four obtained knock-outs, we noted any difference in...”

XP_039685582 protein NRT1/ PTR FAMILY 1.1 from Medicago truncatula
24% identity, 92% coverage

• MtNPF6.5 mediates chloride uptake and nitrate preference in Medicago roots.
  Xiao, The EMBO journal 2021
  • GeneRIF: MtNPF6.5 mediates chloride uptake and nitrate preference in Medicago roots.

S15A1_RAT / P51574 Solute carrier family 15 member 1; Intestinal H(+)/peptide cotransporter; Oligopeptide transporter, small intestine isoform; Peptide transporter 1; Proton-coupled dipeptide cotransporter from Rattus norvegicus (Rat) (see 4 papers)
TC 2.A.17.4.1 / P51574 Peptide:H+ symporter (transports cationic, neutral and anionic dipeptides including glycylsarcosine (gly-sar) (Søndergaard et al., 2008) as well as anserine (β-alanyl-1-N-methyl-L-histidine) and carnosine (β-alanyl-L-histidine) (Geissler et al., 2010); also transports β-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors). It is competitively inhibited by L-4,4'-biphenylalanyl-L-proline (Bip-Pro) with ~10-20µM affinity. Inhibitors/substrates include cefadroxil, Ala-4-nitroanilide and δ-aminolevulinic acid (Knutter et al., 2007). The intracellular loop linking transmembrane domains 6 and 7 of the human dipeptide transporter hPEPT1 includes two amphipathic alpha-helices, with net positive and negative charges which interact and influence conformational changes of hPEPT1 during and after glycylsarcosine transport from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 56% coverage

• function: Electrogenic proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. Transports neutral and monovalently charged peptides with a proton to peptide stoichiometry of 1:1 or 2:1 (By similarity). Primarily responsible for the absorption of dietary di- and tripeptides from the small intestinal lumen (By similarity). Mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system (By similarity).
  catalytic activity: a dipeptide(out) + H(+)(out) = a dipeptide(in) + H(+)(in) (RHEA:64392)
  catalytic activity: an L-amino acid tripeptide(out) + H(+)(out) = an L-amino acid tripeptide(in) + H(+)(in) (RHEA:64400)
  catalytic activity: L-alanyl-L-lysine(out) + H(+)(out) = L-alanyl-L-lysine(in) + H(+)(in) (RHEA:72611)
  catalytic activity: L-alanyl-L-proline(out) + H(+)(out) = L-alanyl-L-proline(in) + H(+)(in) (RHEA:64420)
  catalytic activity: L-alanyl-L-valine(out) + H(+)(out) = L-alanyl-L-valine(in) + H(+)(in) (RHEA:72615)
  catalytic activity: carnosine(out) + H(+)(out) = carnosine(in) + H(+)(in) (RHEA:64404)
  catalytic activity: glycyl-L-glutamine(out) + H(+)(out) = glycyl-L-glutamine(in) + H(+)(in) (RHEA:71671)
  catalytic activity: glycyl-L-leucine(out) + H(+)(out) = glycyl-L-leucine(in) + H(+)(in) (RHEA:71675)
  catalytic activity: glycyl-L-proline(out) + H(+)(out) = glycyl-L-proline(in) + H(+)(in) (RHEA:64428)
  catalytic activity: glycyl-sarcosine(out) + H(+)(out) = glycyl-sarcosine(in) + H(+)(in) (RHEA:64396)
  catalytic activity: L-leucyl-L-leucine(out) + H(+)(out) = L-leucyl-L-leucine(in) + H(+)(in) (RHEA:71715)
  catalytic activity: L-leucyl-L-proline(out) + H(+)(out) = L-leucyl-L-proline(in) + H(+)(in) (RHEA:64424)
  catalytic activity: L-phenylalanyl-L-leucine(out) + H(+)(out) = L-phenylalanyl-L- leucine(in) + H(+)(in) (RHEA:71699)
  catalytic activity: L-phenylalanyl-L-phenylalanine(out) + H(+)(out) = L- phenylalanyl-L-phenylalanine(in) + H(+)(in) (RHEA:71707)
  catalytic activity: L-lysyl-glycine(out) + H(+)(out) = L-lysyl-glycine(in) + H(+)(in) (RHEA:71679)
  catalytic activity: L-tyrosylglycine(out) + H(+)(out) = L-tyrosylglycine(in) + H(+)(in) (RHEA:71711)
  catalytic activity: L-alanyl-L-aspartate(out) + 2 H(+)(out) = L-alanyl-L- aspartate(in) + 2 H(+)(in) (RHEA:71695)
  catalytic activity: L-aspartyl-glycine(out) + 2 H(+)(out) = L-aspartyl-glycine(in) + 2 H(+)(in) (RHEA:71683)
  catalytic activity: glycyl-L-aspartate(out) + 2 H(+)(out) = glycyl-L-aspartate(in) + 2 H(+)(in) (RHEA:71687)
  catalytic activity: glycyl-L-glutamate(out) + 2 H(+)(out) = glycyl-L-glutamate(in) + 2 H(+)(in) (RHEA:71691)
  catalytic activity: L-alanyl-L-leucyl-L-alanine(out) + H(+)(out) = L-alanyl-L- leucyl-L-alanine(in) + H(+)(in) (RHEA:71723)
  catalytic activity: L-alanyl-L-prolylglycine(out) + H(+)(out) = L-alanyl-L- prolylglycine(in) + H(+)(in) (RHEA:64432)
  catalytic activity: glycylglycyl-L-isoleucine(out) + H(+)(out) = glycylglycyl-L- isoleucine(in) + H(+)(in) (RHEA:64436)
  catalytic activity: glycylglycyl-L-proline(out) + H(+)(out) = glycylglycyl-L- proline(in) + H(+)(in) (RHEA:64440)
  catalytic activity: L-methionyl-L-phenylalanyl-L-methionine(out) + H(+)(out) = L- methionyl-L-phenylalanyl-L-methionine(in) + H(+)(in) (RHEA:71719)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + 2 H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + 2 H(+)(in) (RHEA:64408)
  catalytic activity: N-formyl-L-methionyl-L-leucyl-L-phenylalanine(out) + 2 H(+)(out) = N-formyl-L-methionyl-L-leucyl-L-phenylalanine(in) + 2 H(+)(in) (RHEA:75399)
  subunit: Interacts (via extracellular domain region) with trypsin.
• substrates: H+, peptides
  tcdb comment: The rabbit orthologue provides the main pathway for dietary nitrogen uptake. Five tyrosyl residues are important for function and/or substrate binding (Pieri et al. 2009). Human PepT1 is modified by N-glycosylation, and all six asparagine residues in the large extracellular loop between transmembrane domains 9 and 10 are subject to N-glycosylation (Chan et al. 2016)
• PPAR beta/gamma mediates the antihypertensive activity of a synbiotic preparation of Bifidobacterium lactis and Lactobacillus acidophilus in spontaneous hypertensive rats
  Huang, Heliyon 2024
  • “...0.4474 61 Q63269 Inositol 1,4,5-trisphosphate receptor type 3 ITPR3 7 1.9953 0.0090 0.5916 0.4216 62 P51574 Solute carrier family 15 member 1 S15A1 6 2.7542 0.0213 1.3062 0.7479 63 P51870 Cytochrome P450 4F5 CP4F5 7 3.6644 0.0138 1.0186 0.9775 64 P16446 Phosphatidylinositol transfer protein alpha isoform...”

TRIVIDRAFT_79497 uncharacterized protein from Trichoderma virens Gv29-8
24% identity, 81% coverage

• Transcriptome Dynamics Underlying Chlamydospore Formation in Trichoderma virens GV29-8
  Peng, Frontiers in microbiology 2021
  • “...albicans ( Palige et al., 2013 ). In this study, two PTR2 genes (TRIVIDRAFT_50243 and TRIVIDRAFT_79497) were also differentially expressed during CF ( Supplementary Table 2 ). In S3 vs S2, tetrapyrrole binding (GO:0046906) and heme binding (GO:0020037) were the most significantly enriched GO terms in...”
  • “...induction of CF in C. albicans . In our study, two PTR2 genes, TRIVIDRAFT_50243 and TRIVIDRAFT_79497, were up-regulated and highly expressed in TVS2-TVS5 and TVS6-TVS8, respectively ( Supplementary Table 2 ). Phenotypic results showed that chlamydospores initially formed on the tips of the mycelia at the...”

NP_476462 solute carrier family 15 member 1 isoform PepT1 from Rattus norvegicus
22% identity, 56% coverage

• Sex-specific and concentration-dependent influence of Cremophor RH 40 on ampicillin absorption via its effect on intestinal membrane transporters in rats.
  Yin, PloS one 2022
  • GeneRIF: Sex-specific and concentration-dependent influence of Cremophor RH 40 on ampicillin absorption via its effect on intestinal membrane transporters in rats.
• Hypertension alters the function and expression profile of the peptide cotransporters PEPT1 and PEPT2 in the rodent renal proximal tubule.
  Alghamdi, Amino acids 2022 (PubMed)
  • GeneRIF: Hypertension alters the function and expression profile of the peptide cotransporters PEPT1 and PEPT2 in the rodent renal proximal tubule.
• [Role of cholinergic anti-inflammatory pathway in Ghrelin regulation of peptide transporter 1 expression in small intestinal epithelium of septic rats].
  Shao, Zhonghua wei zhong bing ji jiu yi xue 2022 (PubMed)
  • GeneRIF: [Role of cholinergic anti-inflammatory pathway in Ghrelin regulation of peptide transporter 1 expression in small intestinal epithelium of septic rats].
• Diabetes downregulates peptide transporter 1 in the rat jejunum: possible involvement of cholate-induced FXR activation.
  Liang, Acta pharmacologica Sinica 2020
  • GeneRIF: Diabetes downregulates peptide transporter 1 in the rat jejunum: possible involvement of cholate-induced FXR activation.
• Physiological and therapeutic regulation of glucose homeostasis by upper small intestinal PepT1-mediated protein sensing.
  Dranse, Nature communications 2018
  • GeneRIF: Inhibition of upper small intestinal peptide transporter 1 (PepT1), the primary oligopeptide transporter in the small intestine, reverses the preabsorptive ability of upper small intestinal casein infusion to increase glucose tolerance and suppress glucose production.
• Ghrelin upregulates PepT1 activity in the small intestine epithelium of rats with sepsis.
  Liu, Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2017 (PubMed)
  • GeneRIF: The expressions of PepT1 mRNA and protein were higher in ghrelin-treated group rats.
• Evaluation of PepT1 transport of food-derived antihypertensive peptides, Ile-Pro-Pro and Leu-Lys-Pro using in vitro, ex vivo and in vivo transport models.
  Gleeson, European journal of pharmaceutics and biopharmaceutics : official journal of Arbeitsgemeinschaft fur Pharmazeutische Verfahrenstechnik e.V 2017 (PubMed)
  • GeneRIF: PepT1 expression was confirmed by immunofluorescence on monolayers and brush border of rat jejunal tissue.
• Glucose-dependent insulinotropic polypeptide-mediated signaling pathways enhance apical PepT1 expression in intestinal epithelial cells.
  Coon, American journal of physiology. Gastrointestinal and liver physiology 2015
  • GeneRIF: GIP via GIPR activates two signaling pathways, the cAMP pathway through Epac and the PI3K pathway through Akt, to increase the trafficking of PepT1 proteins to the apical membrane.
• More

PDIP_55370 MFS peptide transporter Ptr2, putative from Penicillium digitatum
23% identity, 84% coverage

• Transcriptome Analysis of mfs2-Defective Penicillium digitatum Mutant to Reveal Importance of Pdmfs2 in Developing Fungal Prochloraz Resistance
  Cuan, Microorganisms 2024
  • “...also led to the up-regulation of multiple MFS isogenes, including MFS23 (PDIP_36610), MFS26 (PDIP_64100), MFS27 (PDIP_55370), MFS31 (PDIP_19850), MFS33 (PDIP_55020) ( Table 8 ). All these five MFS-encoding genes did not show up-regulation in the comparison Pd-d-(I/NI); however, three of them (i.e., MFS23 , MFS26 and...”
  • “...1.77 / MFS25 (PDIP_03090) 1.71 1.07 1.38 / MFS26 (PDIP_64100) / / 1.53 1.42 MFS27 (PDIP_55370) / / 1.22 1.47 MFS28 (PDIP_70440) / / 1.26 / MFS29 (PDIP_67290) / / 1.13 / MFS30 (PDIP_09580) / / 1.15 / MFS31 (PDIP_19850) / 2.63 / 2.05 MFS32 (PDIP_28570)...”

GRMZM5G827496 uncharacterized protein LOC100274435 from Zea mays
22% identity, 62% coverage

• Comparative Transcriptome Analysis of Iron and Zinc Deficiency in Maize (Zea mays L.)
  Mallikarjuna, Plants (Basel, Switzerland) 2020
  • “...Nicotianamine synthase 3 16 GRMZM2G069198 Zm.12619.1.A1_at 3.15 1.56 7.28 2.34 3.38 1.67 NRAMP transporter1 17 GRMZM5G827496 Zm.17744.1.A1_at 2.58 1.07 10.36 1.20 3.93 14.55 NRT1/ PTR family 3.1 18 GRMZM2G567452 Zm.10825.1.A2_at 1.34 1.14 1.42 2.91 2.54 1.56 O-methyltransferase 19 GRMZM2G148800 Zm.19137.1.A1_at 1.04 6.72 25.37 48.72 0.75 126.24...”
• Nitrogen transporter and assimilation genes exhibit developmental stage-selective expression in maize (Zea mays L.) associated with distinct cis-acting promoter motifs
  Liseron-Monfils, Plant signaling & behavior 2013
  • “...GRMZM2G076723; GRMZM2G443637 Nitrate reductase (NADH; nr1) 4 ZmN-63* BAB89087.1 GRMZM2G064091 Nitrate transporter 4 ZmN-62 CAA93316.2 GRMZM5G827496 Nitrite transporter (NiTR1 gene) 4 ZmN-61 AAN06953.1 GRMZM2G043193; GRMZM2G080045; GRMZM2G338809 Ammonium transporter (OsAMT3.3) 4 ZmN-60 AAD38068.1 GRMZM2G076723; GRMZM2G443637 Nitrate reductase (NADH; nr1) 4 ZmN-59 CAA93316.2 GRMZM5G827496 Nitrite transporter (NiTR1 gene)...”
  • “...GRMZM2G127134 Oligopeptide and nitrate transporter 2 ZmN-24^ AAG52554.1 GRMZM2G137421 Nitrate transporter (Atntl1) 2 ZmN-23 CAA93316.2 GRMZM5G827496 Nitrite transporter (NiTR1 gene) 2 ZmN-22 CAD41141.1 GRMZM2G138731 Nitrate transporter (nrt15) 2 ZmN-21* P27968 GRMZM5G878558 Nitrate reductase (nr2) 2 ZmN-20^ AAG52554.1 GRMZM2G137421 Nitrate transporter (Atntl1) 2 ZmN-19 NoDescription Na Nitrate...”

Q6AU97 Proton-dependent oligopeptide transporter (POT) from Oryza sativa subsp. japonica
23% identity, 70% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
  Santi, Frontiers in plant science 2017
  • “...2.17 GRMZM2G047431_T01 Q69EY5 GDP dissociation inhibitor protein 2.17 GRMZM2G080178_T01 B6UC24 Sulfate transporter 1.2 2.21 GRMZM2G122712_T01 Q6AU97 Putative proton-dependent oligopeptide transporter (POT) 2.26 2.96 GRMZM2G009344_T01 B4FET6 ATPUP3 2.28 GRMZM2G026523_T01 B4FQ14 Peptide transporter PTR2 2.30 GRMZM2G167758_T01 Q9FMC7 Nuclear transport factor 2 (NTF2) family protein 2.32 AC185254.4_FGT002 Q6ZIV9 Putative...”

LOC103652484 protein NRT1/ PTR FAMILY 4.5 from Zea mays
22% identity, 86% coverage

• Functional analysis of the OsNPF4.5 nitrate transporter reveals a conserved mycorrhizal pathway of nitrogen acquisition in plants
  Wang, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...OsNPF7.2 (LOC4330372), OsNPF8.3 (LOC4336852), OsAMT3.1 (LOC107276856), OsNR1 (LOC4330867), OsNR2 (LOC4345798), OsGS1.1 (LOC4330649), MtNPF4.5 (LOC11406786), ZmNPF4.5 (LOC103652484), and SbNPF4.5 (LOC8062188). Supplementary Material Supplementary File Supplementary File This work was supported by National Key Research and Development Program of China (2016YFD0100700), National Natural Science Foundation of China (31572188,...”

S15A1_RABIT / P36836 Solute carrier family 15 member 1; Intestinal H(+)/peptide cotransporter; Oligopeptide transporter, small intestine isoform; Peptide transporter 1 from Oryctolagus cuniculus (Rabbit) (see 3 papers)
NP_001075806 solute carrier family 15 member 1 from Oryctolagus cuniculus
22% identity, 56% coverage

• function: Electrogenic proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. Transports neutral and monovalently charged peptides with a proton to peptide stoichiometry of 1:1 or 2:1 (PubMed:12082113, PubMed:8139693, PubMed:9051570). Primarily responsible for the absorption of dietary di- and tripeptides from the small intestinal lumen (PubMed:8139693). Mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system.
  catalytic activity: a dipeptide(out) + H(+)(out) = a dipeptide(in) + H(+)(in) (RHEA:64392)
  catalytic activity: an L-amino acid tripeptide(out) + H(+)(out) = an L-amino acid tripeptide(in) + H(+)(in) (RHEA:64400)
  catalytic activity: L-alanyl-L-lysine(out) + H(+)(out) = L-alanyl-L-lysine(in) + H(+)(in) (RHEA:72611)
  catalytic activity: L-alanyl-L-proline(out) + H(+)(out) = L-alanyl-L-proline(in) + H(+)(in) (RHEA:64420)
  catalytic activity: L-alanyl-L-valine(out) + H(+)(out) = L-alanyl-L-valine(in) + H(+)(in) (RHEA:72615)
  catalytic activity: carnosine(out) + H(+)(out) = carnosine(in) + H(+)(in) (RHEA:64404)
  catalytic activity: glycyl-L-glutamine(out) + H(+)(out) = glycyl-L-glutamine(in) + H(+)(in) (RHEA:71671)
  catalytic activity: glycyl-L-leucine(out) + H(+)(out) = glycyl-L-leucine(in) + H(+)(in) (RHEA:71675)
  catalytic activity: glycyl-L-proline(out) + H(+)(out) = glycyl-L-proline(in) + H(+)(in) (RHEA:64428)
  catalytic activity: glycyl-sarcosine(out) + H(+)(out) = glycyl-sarcosine(in) + H(+)(in) (RHEA:64396)
  catalytic activity: L-leucyl-L-leucine(out) + H(+)(out) = L-leucyl-L-leucine(in) + H(+)(in) (RHEA:71715)
  catalytic activity: L-leucyl-L-proline(out) + H(+)(out) = L-leucyl-L-proline(in) + H(+)(in) (RHEA:64424)
  catalytic activity: L-phenylalanyl-L-leucine(out) + H(+)(out) = L-phenylalanyl-L- leucine(in) + H(+)(in) (RHEA:71699)
  catalytic activity: L-phenylalanyl-L-phenylalanine(out) + H(+)(out) = L- phenylalanyl-L-phenylalanine(in) + H(+)(in) (RHEA:71707)
  catalytic activity: L-lysyl-glycine(out) + H(+)(out) = L-lysyl-glycine(in) + H(+)(in) (RHEA:71679)
  catalytic activity: L-tyrosylglycine(out) + H(+)(out) = L-tyrosylglycine(in) + H(+)(in) (RHEA:71711)
  catalytic activity: L-alanyl-L-aspartate(out) + 2 H(+)(out) = L-alanyl-L- aspartate(in) + 2 H(+)(in) (RHEA:71695)
  catalytic activity: L-aspartyl-glycine(out) + 2 H(+)(out) = L-aspartyl-glycine(in) + 2 H(+)(in) (RHEA:71683)
  catalytic activity: glycyl-L-aspartate(out) + 2 H(+)(out) = glycyl-L-aspartate(in) + 2 H(+)(in) (RHEA:71687)
  catalytic activity: glycyl-L-glutamate(out) + 2 H(+)(out) = glycyl-L-glutamate(in) + 2 H(+)(in) (RHEA:71691)
  catalytic activity: L-alanyl-L-leucyl-L-alanine(out) + H(+)(out) = L-alanyl-L- leucyl-L-alanine(in) + H(+)(in) (RHEA:71723)
  catalytic activity: L-alanyl-L-prolylglycine(out) + H(+)(out) = L-alanyl-L- prolylglycine(in) + H(+)(in) (RHEA:64432)
  catalytic activity: glycylglycyl-L-isoleucine(out) + H(+)(out) = glycylglycyl-L- isoleucine(in) + H(+)(in) (RHEA:64436)
  catalytic activity: glycylglycyl-L-proline(out) + H(+)(out) = glycylglycyl-L- proline(in) + H(+)(in) (RHEA:64440)
  catalytic activity: L-methionyl-L-phenylalanyl-L-methionine(out) + H(+)(out) = L- methionyl-L-phenylalanyl-L-methionine(in) + H(+)(in) (RHEA:71719)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + 2 H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + 2 H(+)(in) (RHEA:64408)
  catalytic activity: N-formyl-L-methionyl-L-leucyl-L-phenylalanine(out) + 2 H(+)(out) = N-formyl-L-methionyl-L-leucyl-L-phenylalanine(in) + 2 H(+)(in) (RHEA:75399)
  subunit: Interacts (via extracellular domain region) with trypsin.
• Rabbit SLC15A1, SLC7A1 and SLC1A1 genes are affected by site of digestion, stage of development and dietary protein content.
  Liu, Animal : an international journal of animal bioscience 2019 (PubMed)
  • GeneRIF: Real time-PCR results indicated that SLC15A1, SLC7A1 and SLC1A1 genes throughout the rabbits' entire development and were expressed in all tested rabbit digestive sites, including the stomach, duodenum, jejunum, ileum, colon and cecum.
• β-Klotho as a Negative Regulator of the Peptide Transporters PEPT1 and PEPT2.
  Abousaab, Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2016 (PubMed)
  • GeneRIF: beta-Klotho participates in the regulation of the peptide transporters PEPT1 and PEPT2.
• USP18 Sensitivity of Peptide Transporters PEPT1 and PEPT2.
  Warsi, PloS one 2015
  • GeneRIF: Data suggest that USP18 (Ubiquitin-like specific protease 18) sensitive cellular functions include activity of the peptide transporters PEPT1 and PEPT2.
• SPAK dependent regulation of peptide transporters PEPT1 and PEPT2.
  Warsi, Kidney & blood pressure research 2014 (PubMed)
  • GeneRIF: SPAK is a powerful regulator of peptide transporters PEPT1 and PEPT2
• Residues R282 and D341 act as electrostatic gates in the proton-dependent oligopeptide transporter PepT1.
  Bossi, The Journal of physiology 2011
  • GeneRIF: Appropriate amino acid substitutions of Arg(282) and Asp(341) change the properties of PepT1 in a way that confirms that these parts of the protein act as an electrostatic gate in the transport process.
• The transmembrane tyrosines Y56, Y91 and Y167 play important roles in determining the affinity and transport rate of the rabbit proton-coupled peptide transporter PepT1.
  Pieri, The international journal of biochemistry & cell biology 2009
  • GeneRIF: The role of conserved tyrosines in the transmembrane domains (TMDs) of rabbit PepT1 as predicted by hydropathy plots, was investigated.
• Site-directed mutagenesis of Arginine282 suggests how protons and peptides are co-transported by rabbit PepT1.
  Pieri, The international journal of biochemistry & cell biology 2008
  • GeneRIF: Mutation of rabbit PepT1 arginine282 R282E- and R282D-PepT1 showed an increased charge:peptide stoichiometry over the wild-type 1:1 ratio for the neutral dipeptide Gly-l-Gln, measured using two-electrode voltage clamp.
• Substrate-induced changes in the density of peptide transporter PEPT1 expressed in Xenopus oocytes.
  Mertl, American journal of physiology. Cell physiology 2008 (PubMed)
  • GeneRIF: Report substrate-induced changes in the density of peptide transporter PEPT1 expressed in Xenopus oocytes.
• More
• PepT1 mRNA expression levels in sea bream (Sparus aurata) fed different plant protein sources
  Terova, SpringerPlus 2013
  • “...707 60 Canis lupus familiaris AAL67837 708 60 Sus scrofa AAO43094 708 60 Oryctolagus cuniculus P36836 707 59 Protein annotation Owing to the high similarity between the partial putative amino acid sequence of sea bream ( Sparus aurata ) PepT1 (Genbank accession no. ADE58426.1 ) and...”
• Ocular sustained release nanoparticles containing stereoisomeric dipeptide prodrugs of acyclovir.
  Jwala, Journal of ocular pharmacology and therapeutics : the official journal of the Association for Ocular Pharmacology and Therapeutics 2011

S15A1_MOUSE / Q9JIP7 Solute carrier family 15 member 1; Intestinal H(+)/peptide cotransporter; Oligopeptide transporter, small intestine isoform; Peptide transporter 1; Proton-coupled dipeptide cotransporter from Mus musculus (Mouse) (see 2 papers)
Q9JIP7 bacterial ABC-type protein transporter (EC 7.4.2.5) from Mus musculus (see paper)
NP_444309 solute carrier family 15 member 1 from Mus musculus
22% identity, 56% coverage

• function: Electrogenic proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. Transports neutral and monovalently charged peptides with a proton to peptide stoichiometry of 1:1 or 2:1 (By similarity) (PubMed:11004485). Primarily responsible for the absorption of dietary di- and tripeptides from the small intestinal lumen (By similarity). Mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system (By similarity).
  catalytic activity: a dipeptide(out) + H(+)(out) = a dipeptide(in) + H(+)(in) (RHEA:64392)
  catalytic activity: an L-amino acid tripeptide(out) + H(+)(out) = an L-amino acid tripeptide(in) + H(+)(in) (RHEA:64400)
  catalytic activity: L-alanyl-L-lysine(out) + H(+)(out) = L-alanyl-L-lysine(in) + H(+)(in) (RHEA:72611)
  catalytic activity: L-alanyl-L-proline(out) + H(+)(out) = L-alanyl-L-proline(in) + H(+)(in) (RHEA:64420)
  catalytic activity: L-alanyl-L-valine(out) + H(+)(out) = L-alanyl-L-valine(in) + H(+)(in) (RHEA:72615)
  catalytic activity: carnosine(out) + H(+)(out) = carnosine(in) + H(+)(in) (RHEA:64404)
  catalytic activity: glycyl-L-glutamine(out) + H(+)(out) = glycyl-L-glutamine(in) + H(+)(in) (RHEA:71671)
  catalytic activity: glycyl-L-leucine(out) + H(+)(out) = glycyl-L-leucine(in) + H(+)(in) (RHEA:71675)
  catalytic activity: glycyl-L-proline(out) + H(+)(out) = glycyl-L-proline(in) + H(+)(in) (RHEA:64428)
  catalytic activity: glycyl-sarcosine(out) + H(+)(out) = glycyl-sarcosine(in) + H(+)(in) (RHEA:64396)
  catalytic activity: L-leucyl-L-leucine(out) + H(+)(out) = L-leucyl-L-leucine(in) + H(+)(in) (RHEA:71715)
  catalytic activity: L-leucyl-L-proline(out) + H(+)(out) = L-leucyl-L-proline(in) + H(+)(in) (RHEA:64424)
  catalytic activity: L-phenylalanyl-L-leucine(out) + H(+)(out) = L-phenylalanyl-L- leucine(in) + H(+)(in) (RHEA:71699)
  catalytic activity: L-phenylalanyl-L-phenylalanine(out) + H(+)(out) = L- phenylalanyl-L-phenylalanine(in) + H(+)(in) (RHEA:71707)
  catalytic activity: L-lysyl-glycine(out) + H(+)(out) = L-lysyl-glycine(in) + H(+)(in) (RHEA:71679)
  catalytic activity: L-tyrosylglycine(out) + H(+)(out) = L-tyrosylglycine(in) + H(+)(in) (RHEA:71711)
  catalytic activity: L-alanyl-L-aspartate(out) + 2 H(+)(out) = L-alanyl-L- aspartate(in) + 2 H(+)(in) (RHEA:71695)
  catalytic activity: L-aspartyl-glycine(out) + 2 H(+)(out) = L-aspartyl-glycine(in) + 2 H(+)(in) (RHEA:71683)
  catalytic activity: glycyl-L-aspartate(out) + 2 H(+)(out) = glycyl-L-aspartate(in) + 2 H(+)(in) (RHEA:71687)
  catalytic activity: glycyl-L-glutamate(out) + 2 H(+)(out) = glycyl-L-glutamate(in) + 2 H(+)(in) (RHEA:71691)
  catalytic activity: L-alanyl-L-leucyl-L-alanine(out) + H(+)(out) = L-alanyl-L- leucyl-L-alanine(in) + H(+)(in) (RHEA:71723)
  catalytic activity: L-alanyl-L-prolylglycine(out) + H(+)(out) = L-alanyl-L- prolylglycine(in) + H(+)(in) (RHEA:64432)
  catalytic activity: glycylglycyl-L-isoleucine(out) + H(+)(out) = glycylglycyl-L- isoleucine(in) + H(+)(in) (RHEA:64436)
  catalytic activity: glycylglycyl-L-proline(out) + H(+)(out) = glycylglycyl-L- proline(in) + H(+)(in) (RHEA:64440)
  catalytic activity: L-methionyl-L-phenylalanyl-L-methionine(out) + H(+)(out) = L- methionyl-L-phenylalanyl-L-methionine(in) + H(+)(in) (RHEA:71719)
  catalytic activity: N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(out) + 2 H(+)(out) = N-acetyl-D-muramoyl-L-alanyl-D-isoglutamine(in) + 2 H(+)(in) (RHEA:64408)
  catalytic activity: N-formyl-L-methionyl-L-leucyl-L-phenylalanine(out) + 2 H(+)(out) = N-formyl-L-methionyl-L-leucyl-L-phenylalanine(in) + 2 H(+)(in) (RHEA:75399)
  subunit: Interacts (via extracellular domain region) with trypsin.
• PepT1-knockout mice harbor a protective metabolome beneficial for intestinal wound healing.
  Sung, American journal of physiology. Gastrointestinal and liver physiology 2021
  • GeneRIF: PepT1-knockout mice harbor a protective metabolome beneficial for intestinal wound healing.
• Impact of PepT1 deletion on microbiota composition and colitis requires multiple generations.
  Viennois, NPJ biofilms and microbiomes 2020
  • GeneRIF: Impact of PepT1 deletion on microbiota composition and colitis requires multiple generations.
• A Variant of Peptide Transporter 2 Predicts the Severity of Porphyria-Associated Kidney Disease.
  Tchernitchko, Journal of the American Society of Nephrology : JASN 2017
  • GeneRIF: We tested the hypothesis that PEPT2 genotypes affect the severity and prognosis of porphyria-associated kidney disease
• Glycans in the intestinal peptide transporter PEPT1 contribute to function and protect from proteolysis.
  Stelzl, American journal of physiology. Gastrointestinal and liver physiology 2017 (PubMed)
  • GeneRIF: Glycosylation of PEPT1 confers resistance against proteolytic cleavage by proteinase K, whereas a remarkable intrinsic stability against trypsin, even in the absence of N-linked glycans, was detected.
• The proton-coupled oligopeptide transporter 1 plays a major role in the intestinal permeability and absorption of 5-aminolevulinic acid.
  Xie, British journal of pharmacology 2016
  • GeneRIF: findings suggested a major role of PEPT1 in the intestinal permeability and oral absorption of 5-aminolevulinic acid
• Species differences in the pharmacokinetics of cefadroxil as determined in wildtype and humanized PepT1 mice.
  Hu, Biochemical pharmacology 2016
  • GeneRIF: Data (including data from studies in transgenic/knockout mice) suggest human PEPT1 and mouse PepT1 exhibit different affinities for antibiotic cefadroxil; these differences may account for species differences in intestinal absorption of cefadroxil.
• PepT1 Expression Helps Maintain Intestinal Homeostasis by Mediating the Differential Expression of miRNAs along the Crypt-Villus Axis.
  Zhang, Scientific reports 2016
  • GeneRIF: Results suggest that PepT1 contributes to maintain balance of homeostasis and proper functions in the small intestine, and dysregulated miRNAs and proteins along the crypt-villus axis are highly related to this process.
• MicroRNA-193a-3p Reduces Intestinal Inflammation in Response to Microbiota via Down-regulation of Colonic PepT1.
  Dai, The Journal of biological chemistry 2015
  • GeneRIF: miRNA-193a-3p can target colonic PepT1 and reduce intestinal inflammation.
• More
• Unraveling the Proteomic Landscape of Intestinal Epithelial Cell-Derived Exosomes in Mice.
  Ding, Frontiers in physiology 2022
  • “...0.028 Down 8 Q8K4D3 Slc36a1 Proton-coupled amino acid transporter 1 54.68 0.758 0.013 Down 9 Q9JIP7 Slc15a1 Solute carrier family 15 member 1 1489.24 0.756 0.022 Down 10 O35488 Slc27a2 Very long-chain acyl-CoA synthetase 233.95 0.747 0.091 Not 11 Q3UVU3 Slc30a10 Zinc transporter 10 75.21 0.735...”
• Dataset on the comparative proteomic profiling of mouse saliva and serum from wild type versus the dystrophic mdx-4cv mouse model of dystrophinopathy
  Murphy, Data in brief 2018
  • “...Heat shock protein 75kDa, mitochondrial Trap1 Q8BYR5-5 Isoform 5 of Calcium-dependent secretion activator 2 Cadps2 Q9JIP7 Solute carrier family 15 member 1 Slc15a1 P12023-2 Isoform APP695 of Amyloid beta A4 protein App P97347 Repetin Rptn Q70KF4 Cardiomyopathy-associated protein 5 Cmya5 Q6PZE0 Mucin-19 Muc19 E9Q557 Desmoplakin Dsp...”
• Crystal Structures of the Extracellular Domain from PepT1 and PepT2 Provide Novel Insights into Mammalian Peptide Transport
  Beale, Structure (London, England : 1993) 2015
  • “...of the Extracellular Domains from PepT1 and PepT2 PepT1 ECD from M.musculus (residues 391580, UniProtKB: Q9JIP7 ) was cloned into an N-terminal maltose-binding protein (MBP) fusion expression vector, pOPINM ( Berrow etal., 2007 ). PepT2 ECD from R.norvegicus (residues 410601, UniProtKB: Q63424 ) was cloned into...”

TRIVIDRAFT_50243 uncharacterized protein from Trichoderma virens Gv29-8
22% identity, 95% coverage

• Transcriptome Dynamics Underlying Chlamydospore Formation in Trichoderma virens GV29-8
  Peng, Frontiers in microbiology 2021
  • “...in C. albicans ( Palige et al., 2013 ). In this study, two PTR2 genes (TRIVIDRAFT_50243 and TRIVIDRAFT_79497) were also differentially expressed during CF ( Supplementary Table 2 ). In S3 vs S2, tetrapyrrole binding (GO:0046906) and heme binding (GO:0020037) were the most significantly enriched GO...”
  • “...during the induction of CF in C. albicans . In our study, two PTR2 genes, TRIVIDRAFT_50243 and TRIVIDRAFT_79497, were up-regulated and highly expressed in TVS2-TVS5 and TVS6-TVS8, respectively ( Supplementary Table 2 ). Phenotypic results showed that chlamydospores initially formed on the tips of the mycelia...”

LOC110435376 protein NRT1/ PTR FAMILY 4.5-like from Sorghum bicolor
23% identity, 92% coverage

• Heterogeneous root zone salinity mitigates salt injury to Sorghum bicolor (L.) Moench in a split-root system
  Zhang, PloS one 2019
  • “...) LOC8085190 -0.38 0.27 -0.77 High-affinity nitrate transporter 2.2 ( Oryza sativa subsp. japonica ) LOC110435376 0.34 0.34 0.88 Protein NRT1/ PTR FAMILY 4.6 ( Arabidopsis thaliana ) Potassium LOC8085154 -1.11 1.36 -1.32 Putative potassium transporter 12 ( Oryza sativa subsp. japonica ) LOC8072341 -0.13 0.59...”

NP_989696 solute carrier family 15 member 1 from Gallus gallus
23% identity, 55% coverage

• Spatial transcriptional profile of PepT1 mRNA in the yolk sac and small intestine in broiler chickens.
  Zhang, Poultry science 2017 (PubMed)
  • GeneRIF: There are temporal changes in PepT1 mRNA expression in the yolk sac and the small intestine, which correspond with their expected role in nutrient uptake during the embryonic and posthatch periods.
• PepT1 mRNA expression levels in sea bream (Sparus aurata) fed different plant protein sources
  Terova, SpringerPlus 2013
  • “...( Danio rerio ) (accession no. AAQ65244 ), chicken ( Gallus gallus ) (accession no. NP_989696 ) rabbit ( Oryctolagus cuniculus ) (accession no. AAA21335 ), rat ( Ratus norvegicus ) (accession no. NP_476462 ), and human ( Homo sapiens ) (accession no. NP-005064 ). Amino...”
• Expression of the peptide transporters PepT1, PepT2, and PHT1 in the embryonic and posthatch chick.
  Zwarycz, Poultry science 2013 (PubMed)
  • GeneRIF: The study profiled Peptide transporters 1 and 2 (PepT1 and PepT2) and peptide/histidine transporter 1 (PHT1) mRNA expression in various organs in layer chicks on embryonic d 18 and 20 and d 1, 3, 7, 10, and 14 posthatch.[PepT1, PepT2, PHT1]

6ei3A / Q8PAS2 Crystal structure of auto inhibited pot family peptide transporter (see paper)
22% identity, 80% coverage

• Ligand: (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate (6ei3A)

FOXG_09811 POT family proton-dependent oligopeptide transporter from Fusarium oxysporum f. sp. lycopersici 4287
21% identity, 67% coverage

• Inhibitory Effect and Mechanism of Dryocrassin ABBA Against Fusarium oxysporum
  Wang, International journal of molecular sciences 2025 (no snippet)
• A Major Facilitator Superfamily Peptide Transporter From Fusarium oxysporum Influences Bioethanol Production From Lignocellulosic Material
  Nugent, Frontiers in microbiology 2019
  • “...). The deduced amino acid sequences showed similarity (>80%) with five peptide transporters (FOXG_15681, FOXG_01591, FOXG_09811, FOXG_12388 and FOXG_04876) encoded within the F. oxysporum f. sp. lycopersici (strain 4287) genome. A global sequence similarity search of the F. oxysporum FoPTR2 protein sequence against the NCBI protein...”

LOC100706083 solute carrier family 15 member 1 from Oreochromis niloticus
25% identity, 52% coverage

• Salinity-Dependent Shift in the Localization of Three Peptide Transporters along the Intestine of the Mozambique Tilapia (Oreochromis mossambicus)
  Con, Frontiers in physiology 2017
  • “...respectively. The Nile tilapia slc15a1b (LOC100691459) and slc15a2 (LOC100693193) are localized on LG16_21, while slc15a1a (LOC100706083) is on an unmapped scaffold. Shared synteny was found with the zebrafish genome, where the orthologs were mapped to chromosomes 9 and 6, respectively (Appendix 3 ). Figure 1 Phylogenetic...”

Q0J9C7 Os04g0660900 protein from Oryza sativa subsp. japonica
22% identity, 81% coverage

• Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
  Santi, Frontiers in plant science 2017
  • “...C0P4H8 Phosphate transporter 2.22 GRMZM2G130454_T01 B6UDW9 Lipid transfer protein 2.07 GRMZM2G005293_T01 B6U0S4 Patellin-5 2.06 GRMZM2G150468_T01 Q0J9C7 Os04g0660900 protein 2.09 GRMZM2G093276_T01 E3WCP2 Zinc transporter 2.32 GRMZM2G047762_T01 A0A096QKI7 Uncharacterized protein 2.32 GRMZM2G009045_T01 Q67UA2 Putative phosphate transport protein, mitochondrial 2.46 GRMZM2G477872_T01 AB45G ABC transporter G family member 45 2.70...”

AFUA_1G12240, Afu1g12240 MFS peptide transporter, putaitve from Aspergillus fumigatus Af293
21% identity, 81% coverage

• Characteristics of a Regulator of G-Protein Signaling (RGS) rgsC in Aspergillus fumigatus
  Kim, Frontiers in microbiology 2017
  • “...), including small oligopeptide transporter (AFUA_2G15240), high affinity nitrate transporter NrtB (AFUA_1G17470), MFS peptide transporter (AFUA_1G12240), ammonium transporter MeaA (AFUA_2G05880), and nitrate transporter CrnA (AFUA_1G12850). These findings led us to test a role for the RgsC in nitrogen source sensing. The rgsC mutant was grown on...”
  • “...AFUA_3G03760 Hypothetical protein 3.879 0.004 5733419 AFUA_1G17470 High affinity nitrate transporter NrtB 3.792 0.002 5732250 AFUA_1G12240 MFS peptide transporter, putative 3.759 0.001 5751177 AFUA_8G06350 Esterase family protein 3.707 0.004 5746940 AFUA_6G07060 Alpha/beta hydrolase family protein, putative 3.444 0.003 5749748 AFUA_7G06260 Zinc-containing alcohol dehydrogenase, putative 3.173 0.001...”
• RNA-seq reveals the pan-transcriptomic impact of attenuating the gliotoxin self-protection mechanism in Aspergillus fumigatus
  O'Keeffe, BMC genomics 2014
  • “...0.512 4.047 0.0005 AFUA_1G09120 - 0.272 0.962 2.985 0.002 AFUA_8G00800 - 0.641 0.899 6.795 0.0005 AFUA_1G12240 - 0.347 0.964 5.161 0.0005 AFUA_8G02550 - 0.564 0.819 8.305 0.003 AFUA_7G04290 - 0.464 0.910 2.355 0.0005 AFUA_8G05860 - 0.463 0.861 2.099 0.003 a Gene expression absent in gliT _Glio....”
• Transcriptional and proteomic analysis of the Aspergillus fumigatus ΔprtT protease-deficient mutant
  Hagag, PloS one 2012
  • “...in azole resistance 5.4 AFUA_4G01230 amino acid transporter, putative 5.2 AFUA_6G03060 MFS monosaccharide transporter 5.0 AFUA_1G12240 MFS peptide transporter, putaitve 4.6 AFUA_5G11020 ammonium transporter 4.3 Oxidoreductase activity, GO:0016491 P =0.04 AFUA_8G00480 2 phytanoyl-CoA dioxygenase family protein 41.9 AFUA_8G00560 2 cytochrome P450, similar to SP:P79084:O-methylsterigmatocystin oxidoreductase (...”
• SreA-mediated iron regulation in Aspergillus fumigatus
  Schrettl, Molecular microbiology 2008
  • “...). SreA-mediated iron repression of the aspartic endopeptidase Pep1 (Afu5g13300) and a putative peptide transporter (Afu1g12240) suggests induction of protein degradation by iron starvation, possibly to facilitate iron acquisition. Interestingly, Pep1 was detected in sera of aspergillosis patients suggesting that it is produced by A. fumigatus...”

F6SG69 Solute carrier family 15 member 1 from Equus caballus
22% identity, 56% coverage

• Extracellular domain of PepT1 interacts with TM1 to facilitate substrate transport
  Shen, Structure (London, England : 1993) 2022
  • “...purification of horse PepT1 The PepT1 gene from horse ( Equus caballus , UniProt ID: F6SG69 ) was codon-optimized and cloned into a pFastBac dual vector for production of baculovirus by the Bac-to-Bac method (Invitrogen). Sf9 cells (Invitrogen/Thermo Fisher) at a density of ~310 6 cells/ml...”

PTRB_CANAR / A0A2H0ZNJ6 Peptide transporter PTR_B from Candidozyma auris (Yeast) (Candida auris) (see paper)
22% identity, 82% coverage

• function: Peptide transporter that exploits the inwardly directed proton motive force to facilitate the cellular uptake of di/tripeptides (PubMed:35648145). Shows strong uptake specificity towards the dipeptides Tyr-Phe and Gly-His, when compared to PTR_A and PTR_C (PubMed:35648145).
  catalytic activity: a dipeptide(out) + H(+)(out) = a dipeptide(in) + H(+)(in) (RHEA:64392)
  catalytic activity: an L-amino acid tripeptide(out) + H(+)(out) = an L-amino acid tripeptide(in) + H(+)(in) (RHEA:64400)
  disruption phenotype: Leads to a marked reduction in the transport capabilities of di/tripeptides.

PTR37_ARATH / Q9M1E2 Protein NRT1/ PTR FAMILY 2.7; AtNPF2.7; Nitrate excretion transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
Q9M1E2 ABC-type nitrate transporter (EC 7.3.2.4) from Arabidopsis thaliana (see paper)
TC 2.A.17.3.5 / Q9M1E2 The nitrate excretion transporter1, NaxT1 (in the plasma membranes of plant cells) from Arabidopsis thaliana (Mouse-ear cress) (see paper)
F9K21.230 / RF|NP_190151.1 putative uncharacterized protein F9K21.230 from Arabidopsis thaliana
AT3G45650 NAXT1 (NITRATE EXCRETION TRANSPORTER1); nitrate efflux transmembrane transporter/ transporter from Arabidopsis thaliana
21% identity, 89% coverage

• function: Transporter involved in a passive nitrate efflux. Not competent for chloride transport.
  disruption phenotype: No visible phenotype.
• substrates: nitrate
• The EXO70 inhibitor Endosidin2 alters plasma membrane protein composition in Arabidopsis roots
  Li, Frontiers in plant science 2023
  • “...1 NO AT4G36670 POLYOL/MONOSACCHARIDE TRANSPORTER 6 ATPMT6 0.31 response to temperature stimulus (GO:0009266) 12 NO AT3G45650 Protein NRT1/PTR FAMILY 2.7 NPF2.7 0.35 GO:0015698 12 NO AT5G25820 Exostosin family protein 0.35 root morphogenesis (GO:0010015) 1 NO AT1G65730 Probable metal-nicotianamine transporter YSL7 YSL7 0.37 catabolic process (GO:0009056) 17...”
• Plant nitrogen availability and crosstalk with phytohormones signallings and their biotechnology breeding application in crops
  Xing, Plant biotechnology journal 2023
  • “...Fan etal .( 2009 ); Wang etal .( 2012 ) AtNRT1.4 At2g26690 AtNRT1.7 At1g69870 AtNRT2.7 At3g45650 AtNRT2.1 At1g08090 NO 3 transporters; N uptake and transport; regulated by CTK and ETH O'Brien etal .( 2016 ); Fan etal .( 2009 ); Wang etal .( 2012 ); Tian...”
• Molecular Targets and Biological Functions of cAMP Signaling in Arabidopsis
  Xu, Biomolecules 2021
  • “...the responses to challenges of microorganisms including plant growth-promoting rhizobacteria [ 183 ], and NPF2.7/NAXT1 (AT3G45650) acting as nitrate efflux transporter in roots [ 184 ]. Thus, cAMP is anticipated to regulate plant nitrate signaling. Taken together, we suggest an important role of cAMP signaling in...”
• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...chloride [ 22 ] AtNPF2.6 At3g45660 NPF22 GA 1/4 /MeJA [ 18 ] AtNPF2.7 NAXT1 At3g45650 NPF22 NO 3 [ 52 ]; GA 1/3/4 /MeJA [ 18 ] AtNPF2.9 NRT1.9/GTR3 At1g18880 NPF21 NO 3 [ 53 ]; 4MTB [ 20 ] AtNPF2.10 GTR1 At3g47960 NPF21 NO...”
• Dehydration stress extends mRNA 3' untranslated regions with noncoding RNA functions in Arabidopsis
  Sun, Genome research 2017
  • “...ACT2 (AT3G18780), COR15A (AT2G42540), COR15B (AT2G42530), DREB1A (AT4G25480), ERF4 (AT3G15210), FAMT (AT3G44860), FPA (AT2G43410), NAXT1 (AT3G45650), NFYA5 (AT1G54160), P5CS1 (AT2G39800), PIF5 (AT3G59060), RD29A (AT5G52310), RD29B (AT5G52300), RGP2 (AT5G15650), SCL13 (AT4G17230), SPL2 (AT1G54150), SRX (AT1G31170), and UBL5 (AT5G42300). Plant materials, growth conditions, and treatments The Arabidopsis thaliana...”
• Shoot chloride exclusion and salt tolerance in grapevine is associated with differential ion transporter expression in roots
  Henderson, BMC plant biology 2014
  • “...B (CLC-b) NG11_46088_11883 VIT_19s0015g01850 GSVIVT01014852001 AT1G55620 1.37 2.85E-34 Chloride channel F (CLC-f) NG11_51750_10097 VIT_06s0004g03520 GSVIVT01025107001 AT3G45650 1.27 7.60E-19 Nitrate excretion transporter 1 NG11_44542_25973 VIT_06s0004g03530 GSVIVT01025106001 AT3G45650 1.61 1.24E-32 Nitrate excretion transporter 2 NG11_46422_21127 VIT_11s0016g05170 GSVIVT01015522001 AT2G26690 1.22 2.58E-19 Nitrate transporter 1.4 CUST_37073_22417 VIT_01s0127g00070 GSVIVT01013802001 AT1G12940 0.63...”
  • “...12 NG11_46088_11883 VIT_19s0015g01850 GSVIVT01014852001 AT1G55620 1.37 2.85E-34 70.44 CLCf (chloride channel F) NG11_44542_25973 VIT_06s0004g03530 GSVIVT01025106001 AT3G45650 1.61 1.24E-32 66.55 Nitrate excretion transporter 2 NG2_21308_18913 VIT_11s0016g02570 GSVIVT01015240001 AT2G19690 3.01 1.05E-26 56.42 Phospholipase A2 precursor NG2_12381_40127 VIT_06s0004g06340 GSVIVT01024768001 AT5G58800 3.35 5.46E-26 54.67 Flavodoxin-like quinone reductase 1 NG2_21123_37199 VIT_12s0028g02740...”

TC 2.A.17.2.2 / P32901 Peptide:H+ symporter (dipeptides and tripeptides preferred (Cai et al., 2007). Substrate preference is altered by mutations in the fifth TMS of Ptr2p from Saccharomyces cerevisiae (Baker's yeast) (see 7 papers)
PTR2 / RF|NP_013019.1 peptide transporter PTR2 from Saccharomyces cerevisiae (see paper)
YKR093W Integral membrane peptide transporter, mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p from Saccharomyces cerevisiae
NP_013019 Ptr2p from Saccharomyces cerevisiae S288C
24% identity, 79% coverage

• substrates: H+, peptides
• Synthetic two-species allodiploid and three-species allotetraploid Saccharomyces hybrids with euploid (complete) parental subgenomes
  Antunovics, Scientific reports 2023
  • “...X 10.32 10 10.14 6 6.281 CYR1 YJL005W X 10.258 10 10.218 12 12.76 PTR2 YKR093W XI 11.359 11 11.331 11 11.329 STE6 YKL209C XI 11.18 11 11.13 11 11.13 MAG2 YLR427W XII 12.627 12 12.520 10 10.544 LEU3 YLR451W XII 12.651 12 12.544 10 10.569...”
• Insights into cell robustness against lignocellulosic inhibitors and insoluble solids in bioethanol production processes
  Moreno, Scientific reports 2022
  • “...6.68E-03 YAL067C, YBL042C, YBR068C, YBR069C, YBR298C, YDL247W, YEL065W, YER145C, YGR055W, YGR295C, YHL035C, YHL040C, YHL047C, YKL220C, YKR093W, YLL038C, YLL048C, YLL051C, YLL052C, YLL053C, YLR047C, YLR214W, YLR237W, YNL328C, YOR382W, YOR384W, YPL265W GO:0,006,810 Homeostatic process 1.65E-02 YEL065W, YER145C, YHL040C, YHL047C, YKL220C, YLL051C, YLR047C, YLR136C, YLR214W, YOR382W, YOR384W, YPL156C GO:0,042,592 a...”
• Metabolic enzyme clustering by coiled coils improves the biosynthesis of resveratrol and mevalonate
  Fink, AMB Express 2020
  • “...were directed to the INT59 integration site, a non-coding region between SRP40 (YKR092C) and PTR2 (YKR093W) located on chromosome XI. The genomic target sequence for the sgRNA was AGAAAACTCTTAGCTTTTCC. Transformants were checked for the correct integration of the expression cassettes by PCR. Prior to growth experiments,...”
• CRISPR/Cpf1 enables fast and simple genome editing of Saccharomyces cerevisiae
  Verwaal, Yeast (Chichester, England) 2018
  • “...chromosome XV. INT2 is a noncoding region between SRP40 ( YKR092C ) and PTR2 ( YKR093W ) located on chromosome XI. INT3 is a Ty4 long terminal repeat (YPRCtau3), located on chromosome XVI, and has been described by Flagfeldt et al ., ( 2009 ). Determination...”
• Structural insights into the π-π-π stacking mechanism and DNA-binding activity of the YEATS domain
  Klein, Nature communications 2018
  • “...be regulated by Taf14 interaction with H3K9acyl, including YBL041, YPR145, YPR158, YER145C, YKL150W , and YKR093W 14 . For control, we also included several genes, such as YLR290, YAL017 ,and MRPL10 , which were shown not to be regulated by Taf14 14 . Intriguingly, although the...”
  • “...genes similar to that of the taf14 W81A mutant ( YBL041, YPR158, YKL150W , and YKR093W ), whereas in other cases, the taf14 G82A mutant showed distinct effects on gene transcripts not seen in either the taf14 W81A mutant or the TAF14 deletion ( YPR145 and...”
• A New Method, "Reverse Yeast Two-Hybrid Array" (RYTHA), Identifies Mutants that Dissociate the Physical Interaction Between Elg1 and Slx5
  Lev, Genetics 2017
  • “...UFD2 SSA1 FES1 YDR503C LPP1 YDR219C MFB1 Transport YKR093W PTR2 YBR172C SMY2 YOR357C SNX3 YJR135W-A TIM8 Translation and RNA processing YGL135W RPL1B YKL156W...”
  • “...YBR010W YLR361C YDR503C YMR284W YDR346C YDR219C YHR134W YAL005C YNL072W YKR093W YDR393W YDL190C YCL030C 4 11 11 12 14.5 15.5 16.5 22 22.5 24 26.5 27 32 32.5...”
• The switch from fermentation to respiration in Saccharomyces cerevisiae is regulated by the Ert1 transcriptional activator/repressor
  Gasmi, Genetics 2014
  • “...-- -- PTR2 YGR050C YML091C YBR183W YBR182C-A YEL020C-B YKR093W QDR3 PHD1 -- HXT8 YBR043C YLR043W YLR044W YJL214W IMA5 PMA1 TKL1 DIP5 YJL216C YGL008C YPR074C...”
  • “...RPM2 YML091C YPC1 YBR183W - YBR182C-A YEL020C-B PTR2 YKR093W QDR3 YBR043C HMS1 YOR032C PHD1 YKL043W HXT8 Peroxisomal membrane signal receptor required for...”
• Transcription analysis of recombinant industrial and laboratory Saccharomyces cerevisiae strains reveals the molecular basis for fermentation of glucose and xylose
  Matsushika, Microbial cell factories 2014
  • “...YLR237W THI7 2.33 2.97 2.05 2.14 Plasma membrane transporter responsible for the uptake of thiamine YKR093W PTR2 2.32 2.69 8.30 8.87 Integral membrane peptide transporter ATP synthesis YBR085W AAC3 3.42 3.08 4.89 3.68 Mitochondrial inner membrane ADP/ATP translocator Q0080 ATP8 4.25 5.61 3.65 4.33 Subunit 8...”
• More
• Critical role of the proton-dependent oligopeptide transporter (POT) in the cellular uptake of the peptidyl nucleoside antibiotic, blasticidin S.
  Kitamura, Biochimica et biophysica acta. Molecular cell research 2017 (PubMed)
  • GeneRIF: some mutants of Ptr2 that are dysfunctional in dipeptide uptake were still competent to transport BlaS. Mouse-derived oligopeptide transporter PepT1 conferred BlaS sensitivity in the S. cerevisiae ptr2 mutant
• Functional implications and ubiquitin-dependent degradation of the peptide transporter Ptr2 in Saccharomyces cerevisiae.
  Kawai, Eukaryotic cell 2014
  • GeneRIF: Ptr2 mutants of the peptide-binding site exhibited severe defects in peptide import and were subject to Rsp5-dependent degradation suggesting that Ptr2 undergoes quality control that renders Ptr2 subject to efficient ubiquitination and degradation.
• Analysing the substrate multispecificity of a proton-coupled oligopeptide transporter using a dipeptide library.
  Ito, Nature communications 2013
  • GeneRIF: The substrate multispecificity of PTR2 indicates that it has an important role in the preferential uptake of vital amino acids.
• Differential regulation and substrate preferences in two peptide transporters of Saccharomyces cerevisiae.
  Cai, Eukaryotic cell 2007
  • GeneRIF: These studies highlight the complementary activities of two dipeptide transport systems under different regulatory controls in common laboratory yeast strains.
• Yeast α-arrestin Art2 is the key regulator of ubiquitylation-dependent endocytosis of plasma membrane vitamin B1 transporters
  Savocco, PLoS biology 2019
  • “...correspond to the geometric means from 6 independent experiments. Accession Name WT + CHX/WT ctrl P32901 PTR2 0.03 Q05998 THI7 0.14 P38631 FKS1 0.18 P04817 CAN1 0.19 Q01896 ENA2 0.24 P32791 FRE1 0.31 P32466 HXT3 0.35 P38085 TAT1 0.38 Q06689 INA1 0.41 P32465 HXT1 0.42 P39004...”
  • “...CHX/WT+CHX art6+ CHX/WT+CHX art7 +CHX/WT+CHX art8 +CHX/WT+CHX art9 +CHX/WT+CHX art10 +CHX/WT+CHX bul1 +CHX/WT+CHX bul2 +CHX/WT+CHX P32901 PTR2 9.0 10.8 10.8 6.2 11.2 8.6 2.6 4.4 2.6 2.3 17.7 2.4 Q05998 THI7 1.2 4.1 1.0 0.6 0.8 0.4 0.3 0.3 11.3 0.3 0.5 0.3 P38631 FKS1 5.2...”
• Study of the Plasma Membrane Proteome Dynamics Reveals Novel Targets of the Nitrogen Regulation in Yeast
  Villers, Molecular & cellular proteomics : MCP 2017
  • “...compounds Q06593 P15365 P19145 P41948 P33413 P06775 P32901 P50276 Other transporters P32467 P38227 P33302 Plasma membrane ATPase P05030 Components of eisosomes...”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...P42838 P13186 P23292 P13185 PM PM and MT PM PM PM PM,EIS P32901 Q12335 Q12412 P39105 P05030 P53252 PM and VAC Q12252 PM PM PM PM and CS PM and other PM PM and...”
• Harnessing natural diversity to probe metabolic pathways
  Homann, PLoS genetics 2005
  • “...and gene products discussed in this paper are ASP3 (P11163), Cup9p (P41817), DAL5 (P15365), Ptr2p (P32901), and Ubr1p (P19812). We thank John McCusker, Barbara Garvik, Gerald Fink, and Rodney Rothstein for providing the strains utilized in this study. We are also grateful to Gerald Fink for...”

PTR9_ARATH / Q0WP01 Protein NRT1/ PTR FAMILY 5.10; AtNPF5.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G22540 proton-dependent oligopeptide transport (POT) family protein from Arabidopsis thaliana
24% identity, 47% coverage

• Genome-wide characterization, expression analyses, and functional prediction of the NPF family in Brassica napus
  Wen, BMC genomics 2020
  • “...GA 1/4 [ 18 ] AtNPF5.7 At3g53960 NPF51 ABA/GA 1/3/4 /MeJA [ 18 ] AtNPF5.10 At1g22540 NPF51 NO 3 [ 61 ] AtNPF6.2 NRT1.4 At2g26690 NPF61 NO 3 [ 62 ] AtNPF6.3 NRT1.1/CHL1 At1g12110 NPF61 NO 3 [ 6 ]; IAA [ 19 ] IAA AtNPF7.2...”
• AtNPF5.5, a nitrate transporter affecting nitrogen accumulation in Arabidopsis embryo
  Léran, Scientific reports 2015
  • “...oocytes, and screened for dipeptide and nitrate transport activity. We identified NPF5.5 (At2g38100) and NPF5.10 (At1g22540) as new nitrate transporters. We demonstrate that NPF5.5 is expressed in the embryo and affects its nitrogen content. Results To optimize the expression of NPFs in heterologous system we used...”
  • “...N accumulation, similar to the NPF6.3/NRT1.1 level: NPF5.5 (At2g38100). Another member of this subfamily, NPF5.10 (At1g22540), induce higher 15 N accumulation than control oocytes, even if the accumulation level is lower than for NPF5.5 ( Figure 2 ). This screen should be continued with the NPF...”
• Transcriptional programs regulated by both LEAFY and APETALA1 at the time of flower formation
  Winter, Physiologia plantarum 2015
  • “...for this response. Three other transporters of this family were among the 196 LFY/AP1 targets: AT1g22540, AT1g52190 and At3g16180. The latter two have recently been implicated in nitrate transport ( Hsu and Tsay 2013 ). It will be of interest to determine what peptides and other...”
• The nitrate transporter (NRT) gene family in poplar
  Bai, PloS one 2013
  • “...Arabidopsis AtNRT1s (At1G33440 and At1G97940) in subclade PtNRT1a. Six Populus PtNRT genes are orthologs of At1G22540 in subclade PtNRT1c. In subclade PtNRT1d, six Populus PtNRT1 genes are similar to At1G52190 and At3G16180. No multiplication was found in clades NRT2 and NRT3. Members of AtNRT3 are duplicated...”
• Nitrogen affects cluster root formation and expression of putative peptide transporters
  Paungfoo-Lonhienne, Journal of experimental botany 2009
  • “...et al. , 1995 ). HaPTR5 shared the highest similarity with HaPTR12 (72% identity), Arabidopsis At1g22540 (60% identity), and At1g72140 and At1g72130 (51% identity, each). The two latter genes are expressed to a higher level in root than in shoot of Arabidopsis ( Tsay et al....”
• Genetic structure, linkage disequilibrium and signature of selection in Sorghum: lessons from physically anchored DArT markers
  Bouchet, PloS one 2012
  • “...RPP13-like protein 1 5.E-59 46 D b b+l FI849032 0.10 (1.30) 0.01 (2.E-05) 9/Sb09g021330 0.0 Q0WP01 Probable peptide/nitrate transporter 2.E-151 72 o b b+l FI849030 0.10 (1.25) 0.01 (0) 9/Sb09g028567 0.7 No hit _ _ _ _ b b+l FI849109 0.10 (1.10) 0.02 (0) 10/Sb10g023860 0.0...”

PTR2 / AAC37368.1 permease from Saccharomyces cerevisiae (see paper)
24% identity, 79% coverage

NP_001320833 Major facilitator superfamily protein from Arabidopsis thaliana
27% identity, 41% coverage

• AtPTR4 and AtPTR6 are differentially expressed, tonoplast-localized members of the peptide transporter/nitrate transporter 1 (PTR/NRT1) family.
  Weichert, Planta 2012 (PubMed)
  • GeneRIF: AtPTR6 is highly expressed in pollen and during senescence.

NP_001321216 Major facilitator superfamily protein from Arabidopsis thaliana
23% identity, 73% coverage

• Tonoplast-localized nitrate uptake transporters involved in vacuolar nitrate efflux and reallocation in Arabidopsis.
  He, Scientific reports 2017
  • GeneRIF: At1g72130 (NPF5.11) is involved in the nitrate from vacuoles into cytosol, thus serving as important player to modulate nitrate allocation between roots and shoots.

PTR43_ARATH / Q9M171 Protein NRT1/ PTR FAMILY 2.1; AtNPF2.1; Protein NAXT1-like 6; Putative nitrate excretion transporter 7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
22% identity, 90% coverage

• function: Transporter involved in a passive nitrate efflux.

ptr2 / AAA53173.1 ptr2 from Arabidopsis thaliana (see paper)
26% identity, 82% coverage

Q2R726 Os11g0283500 protein from Oryza sativa subsp. japonica
24% identity, 68% coverage

• Spatial gradients in cell wall composition and transcriptional profiles along elongating maize internodes.
  Zhang, BMC plant biology 2014
  • “...0.87 At1g62990 E-109 AtIRX11 BAG (Q5N9K2) 0.93 0.92 0.94 At3g51780 E-40 AtBAG4 POT family protein (Q2R726) 0.84 0.93 0.90 At1g27040 E-83 - VP1/ABI3 (Q6Z3U3) 0.78 0.92 0.85 At4g32010 E-152 AtHSL1 MYB (Q0J3I9) 0.81 0.90 0.83 At5g67300 E-54 AtMYBR1 F-box (Q5VR67) 0.84 0.91 0.79 At2g26850 E-79 -...”

LOC4335932 protein NRT1/ PTR FAMILY 4.4 from Oryza sativa Japonica Group
23% identity, 90% coverage

• Physico-chemical characterization and transcriptome analysis of 5-methyltryptophan resistant lines in rice
  Nogoy, PloS one 2019
  • “...inner membrane translocase subunit TIM17-2 (LOC4343846) 20 up LOC_Os04g36040 transporter protein NRT1/ PTR FAMILY 4.4 (LOC4335932) 20 up LOC_Os01g31870 cation transporter metal transporter Nramp4 (LOC4324486) 5 up LOC_Os02g55440 transporter transmembrane 9 superfamily member 11 (LOC4331019) 20 up LOC_Os07g38610 transporter CMP-sialic acid transporter 2 (LOC4343687) 20 up...”